KEGG   Cicer arietinum (chickpea): 101500295Help
Entry
101500295         CDS       T02819                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00020  Citrate cycle (TCA cycle)
cam00190  Oxidative phosphorylation
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
cam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101500295
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101500295
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101500295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 101500295
NCBI-ProteinID: XP_004512040
UniProt: A0A1S2YYS3
LinkDB All DBs
Position
Ca8
AA seq 623 aa AA seqDB search
MWRCVARGLRASSSNTRSHVSRFFSSGVNSSYTVVDHTYDAIVVGAGGAGLRAAIGLSEH
GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMC
REAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHT
LYGQAMRHNTQFFVEYFALDLLMNKDGSCQGVIALNMEDGTLHRFQAASTILATGGYGRA
YFSATSAHTCTGDGNAMVARAGIPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE
GERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPG
ISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDNPDALVPGLMAAGET
ACASVHGANRLGANSLLDIVVFGRACANRVAEINRPGEKQKPLEKDAGEKTIAWLDKLRN
SNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFSDVQVKDRTLIWNTD
LIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDESWMKHTLGFWENEKVRLD
YRPVHLNTLDDEVESFPPKARVY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgttgcgtcgctcgtggacttcgtgcatcatcttctaacactagatctcacgtt
tctagattcttctctagtggggtaaactcgtcttacaccgttgtggatcatacttatgat
gcaattgtcgtaggggctggtggtgcaggtttgagagctgctattggactctcagaacat
ggattcaatactgcttgtattaccaaactgttcccaactcgttcacacactgttgcagct
cagggtggcatcaatgctgcattgggaaatatgactgaagatgactggaggtggcacatg
tatgacactgtcaaaggaagtgattggctaggagatcaggatgccatccaatatatgtgt
agggaggcaccgaaagcagtcattgagcttgagaattatggattgccattttcccgaact
gaagatggaagaatataccagcgagcatttggtggtcaaagcttgaacttcggaaaaggt
ggtcaagcttaccgctgtgcatgtgctgctgatcgaactgggcatgctttgttgcacact
ctctatggccaggctatgagacacaatacacagttttttgtggaatattttgccttggat
cttttaatgaataaggatggcagttgccaaggagtgattgccttaaatatggaagatgga
acactacatcgtttccaagctgcttcaacaattttggccacagggggttatggtagagca
tacttctctgcaacctcagcacatacatgcactggagatggcaacgccatggttgcacgt
gctggaatcccccttgaggatttagagtttgtgcaatttcacccaacaggtatatatgga
gcaggttgccttataacagaaggttctcgtggtgaaggtggaattcttaggaatagcgag
ggggagcggtttatggaacgatatgctcctacagcaaaagatcttgcatccagagacgta
gtttcgagatcgatgactatggagatccgggaaggtcgtggtgtaggacctctgaaagat
cacatctatctacacttgaatcatctacccccagatgtgctcaaggagagacttcctggt
atctctgaaactgctgctatttttgctggtgtggatgttacaaaggaacctattcctgtt
ttgccaactgtgcattataacatgggtggcattcccacaaatcatcatggagaggtggtt
accattaaaggtgacaatccggatgcattagttcctggattgatggctgctggagaaaca
gcctgtgcatcagttcatggtgccaacaggcttggtgcaaattcacttttggacattgtt
gttttcggtagagcttgtgcaaacagagttgcagaaattaatagaccaggagagaaacaa
aagcctttagagaaggatgctggggagaaaacgattgcatggctggacaaattgagaaat
tcaaatggttcattacctacttcaaaaattcggctgaatatgcaacgagtaatgcaaaat
aatgctgctgtattccgtactcaagaaacattagaagaaggttgtcaattaattgataaa
acatgggagagttttagtgatgtccaggtgaaagatcggactttaatatggaacacggac
ttgatcgagactattgagttggaaaatcttctgataaatgcctgcatcacaatgcactct
gcagaagctaggaaagagagtagaggagctcatgcccgtgaggacttcacgaaaagagac
gacgagagctggatgaaacacactttgggattctgggagaacgagaaggtccgattggat
tacaggccggtccacttgaatacattggatgatgaggttgaatcattccctcccaaggct
cgtgtgtattaa

DBGET integrated database retrieval system