KEGG   Cicer arietinum (chickpea): 101502335Help
Entry
101502335         CDS       T02819                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00010  Glycolysis / Gluconeogenesis
cam00020  Citrate cycle (TCA cycle)
cam00620  Pyruvate metabolism
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
cam01200  Carbon metabolism
Module
cam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101502335
   00020 Citrate cycle (TCA cycle)
    101502335
   00620 Pyruvate metabolism
    101502335
Enzymes [BR:cam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     101502335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DciA GCV_H
Motif
Other DBs
NCBI-GeneID: 101502335
NCBI-ProteinID: XP_004497103
UniProt: A0A1S2XZX6
LinkDB All DBs
Position
Ca4
AA seq 485 aa AA seqDB search
MNAHCSSSSSIFSMASPSLRNSTTNLSFSTLILPRSSSPRRRPSSFKIQAKIREIFMPAL
SSTMTEGKIVSWIKSEGDTLSKGDSVVVVESDKADMDVETFYDGILAAIVVNEGETAPVG
APIGLLAETPEDIAEAQAKAKSVKSASSSSSSSSPPIEDTPPVNSQPPPPPPPAAKSVSD
GPKKIVATPQAKKLAKQHKVDIASLSGTGPFGRITPEDVEAAAGITPSKSNVAPAVATPT
PAASVQPTKSAAAGSSSAALLPGSSVVPFTTMQSAVSKNMVESLSVPTFRVGYPVTTDAL
DALYEKVKPKGVTMTAILAKAVAMALVQHPVVNATCKDGKNFHYNSNINVAVAVAINGGL
ITPVLQDADKLDLYLLSQKWKELVGKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILP
PGQGAIMAVGASKPTVLADADGFFRVKSKMLVNVTADHRIIYGADLAAFLQTFSKIIENP
ESLTL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacattgttcttcttcctcttcgatattctctatggcttctccttctcttcgc
aactcaacaacaaacctttcattctcaactctcatcctcccccgttcctcatcccctcgc
cgccgaccttcttccttcaaaatccaagccaagatccgcgaaatcttcatgcccgcactc
agttcaacaatgactgagggtaaaatcgtctcctggattaaatctgaaggcgatactctc
tctaaaggcgatagtgtcgtcgtcgttgaatccgataaagctgatatggacgttgaaacg
ttttacgatggaattctcgctgctattgttgttaatgaaggtgaaactgctcccgttggt
gctcccattggtttgcttgcggagactcctgaagatatcgctgaagctcaagctaaagcc
aaatccgtcaaatccgcttcttcttcttcttcttcgtcttctccgccaatcgaggatact
cctccggtgaattctcaacctcctcctcctcctccgccggcggctaagtctgtttccgat
ggtccgaagaaaattgtggctacacctcaggcgaagaagcttgcaaaacagcacaaggtc
gacattgcatcgctctccgggacaggtccgtttggccggatcacgccggaagatgtcgag
gctgccgccgggattacaccgtcgaagagtaatgtagctccggcggtggcgactcctact
ccggcggcgtcggttcaaccaacaaaatcagctgctgctggttcttcttctgctgctttg
cttccaggttccagtgttgttcctttcacgacgatgcaatctgctgtttctaagaatatg
gtggagtctctctctgtgcctacattccgtgttgggtatcctgtcaccactgatgctctt
gatgctctctacgagaaggtgaaacctaagggtgtgaccatgactgctatattggctaag
gctgttgctatggcacttgttcagcatccagttgtcaatgccacctgcaaagacggcaag
aactttcactataacagtaacattaatgttgctgttgctgtggcaatcaatggtggcttg
ataaccccagttcttcaggatgctgataagttggacttgtatctgttgtctcaaaaatgg
aaagaactagttggaaaggctcgttcaaagcaattgcaacctcatgagtataattcagga
actttcacactttccaatttgggtatgtttggagttgacaggtttgatgccatacttcct
ccaggccagggcgctatcatggctgttggagcatcaaagcctactgtactggccgatgca
gatggattcttcagagtgaaaagtaaaatgctggtgaatgtaacagctgatcaccgaata
atttatggggctgacctggctgccttccttcagacattctctaaaatcattgaaaaccca
gaaagcctaacattatag

DBGET integrated database retrieval system