KEGG   Cicer arietinum (chickpea): 101506967Help
Entry
101506967         CDS       T02819                                 

Definition
(RefSeq) alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00500  Starch and sucrose metabolism
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101506967
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101506967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 101506967
NCBI-ProteinID: XP_004499059
UniProt: A0A1S2Y488
LinkDB All DBs
Position
Ca4
AA seq 420 aa AA seqDB search
MDSLPWLSLFCLSIFPLLASSTLLFQGFNWESSSKGGWYNLLKNSIPDLANAGITHVWLP
PPSQSVGSQGYLPGRLYDLDASKYGSKDELKSLIKAFNDKGIKSLADIVINHRTAERKDG
RGIYCLFEGGTPDTKLDWGPSFICKDDTTYSDGTGNLDTGEDYNAAPDIDHLNPQVQREL
SEWMNWLKTEIGFSGWRFDFVKGYAPSITKIYVENTSPDFAVGEYWNSLSYGQDGKCDYN
QDKARGELVNWVESSGAGVVNAFDFTTKGILQAAVEGELWRLKDSNGKPPGLIGLKPENA
VTFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHLFDWGLKEQITKLTAIR
VRNGINMKSTVNILAADGDIYVAKIDNKIIVKIGPKMDLGNLVPSNFHVATSGQDYAVWE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggattctcttccttggctcagtcttttctgcctttcaatttttcctcttttagcttcc
tctactttgctctttcagggattcaactgggaatcaagtagcaaaggaggatggtacaac
ttgttgaagaactccattcctgacttagcaaatgcaggaattactcatgtttggctccct
cctccatctcaaagtgttggttctcaagggtatcttccaggaagactatatgatcttgat
gcatcaaaatatggttccaaggatgaactaaagtcccttataaaggcctttaatgataaa
ggaataaagagcctagctgacatagtaatcaaccatagaactgcagagagaaaagatgga
agaggtatttactgtctctttgaaggtgggaccccagatacaaaacttgattggggtcca
tctttcatttgcaaagatgacacaacttattcagacggcactggaaatcttgatactgga
gaagattacaatgctgcacctgacattgatcatttaaatcctcaagtacaaagagagtta
tctgaatggatgaattggttaaaaactgaaattggtttttctggatggagatttgatttt
gtgaaaggttatgctcctagtataacaaagatttatgtggaaaatacttcaccagatttt
gctgttggagagtattggaattcactttcttatggacaagatggaaagtgtgattataat
caagataaagctagaggtgaacttgtgaattgggttgaatctagtggtgctggtgttgtt
aatgcatttgattttactactaaagggattcttcaagctgctgttgaaggagaactttgg
aggttgaaagattcgaatggaaaaccacctggtttgattggtttgaaacctgaaaatgct
gttacatttattgataaccatgatacaggttctactcagaaactttggccatttccttct
gataaagttatgcagggttatgcttatatattaacacatcctgggacaccatcaatattc
tacgaccacttatttgattggggactgaaggagcagataacaaaattgacagcaattaga
gtgaggaatgggatcaacatgaaaagcacagtgaacattctagcagcagatggtgacatt
tatgtggcaaagatagataacaagattattgtgaagataggtccaaagatggaccttgga
aatcttgttccctcaaatttccacgttgctacctctggtcaagattatgccgtgtgggag
tga

DBGET integrated database retrieval system