KEGG   Cicer arietinum (chickpea): 101507582Help
Entry
101507582         CDS       T02819                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00250  Alanine, aspartate and glutamate metabolism
cam00410  beta-Alanine metabolism
cam00430  Taurine and hypotaurine metabolism
cam00650  Butanoate metabolism
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
Module
cam_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101507582
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101507582
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101507582
   00430 Taurine and hypotaurine metabolism
    101507582
Enzymes [BR:cam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101507582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 101507582
NCBI-ProteinID: XP_004515245
UniProt: A0A1S2Z552
LinkDB All DBs
Position
Un
AA seq 499 aa AA seqDB search
MVITSTVTHPDEHRQNIDCTFASRYVREPVPKFKMPESSIPKDAAYQIINDELMLDGKPR
LNLASFVTTWMEPECDKLIMASLNKNYVDMDEYPVTTELQNRCVNIIAHLFNAPIGAEET
AVGVGTVGSSEAIMLAGLAFKRKWQTKRKLEGKPYDKPNIVTGANVQVCWEKFARYFEVE
LKEVKLREGYYVMDPLKAVEMVDENTICVAAILGSTLTGEFEDVKLLHELLTKKNKETGF
DTPIHVDAASGGFVAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKEDLP
DDLVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNVMENCLENTIVLKKG
IEKTGRFNILSKDVGVPLVAFTLKDSSHHTVFEIADHLRKYGWIVPAYTMPADAQHIAVL
RVVIREDFSCSLAERLVSDIDKVVKHLDTLPSTVSIKSAHVTASTSEDSEKVKKDVKESH
DAITKYWKKLVDGKTVGTC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcacatcaactgttacacacccagatgaacatagacaaaacatagactgtact
tttgcttctagatatgtgcgtgaaccagttccaaagttcaagatgccagagagttctata
ccaaaggatgcagcatatcaaataataaatgatgagttgatgttagatggtaagccaagg
cttaacttggcttcatttgtgacaacttggatggagcctgagtgtgataagcttatcatg
gcttcactcaacaagaactatgttgacatggatgagtaccctgtcactactgagcttcag
aaccggtgtgtgaatataatagcacatctattcaatgctcctattggtgcagaggaaact
gcagtaggtgtggggaccgttggttcatcagaggcaataatgttagctggtttagctttc
aaaagaaaatggcagactaagagaaaattagaaggcaaaccatatgataagcctaacata
gttactggtgctaatgtgcaggtttgttgggaaaagtttgctagatactttgaagttgaa
ctaaaggaagtgaaactaagagagggatactatgtgatggacccattgaaagcagttgaa
atggtagatgagaacaccatatgtgttgcagccattttagggtcaacgctaaccggagag
tttgaggatgtgaagcttcttcacgaacttcttactaaaaagaacaaggagacaggattc
gatactccaattcatgtcgacgctgcgagtggcggttttgttgctccgtttctctaccct
gatctagaatgggattttcgtttgccgttggtgaagagcatcaatgttagtggtcacaag
tatggtcttgtttatcccggtgttggttgggttgtctggaggagtaaagaggacttgccg
gatgatcttgttttccatatcaattatcttggatctgatcagccaactttcacattgaat
ttctccaaaggatcgagtcaaatcattgctcaatactaccaattcatacgccttggcttc
gagggctacaaaaatgtaatggaaaattgcttggagaatacaatagttttgaagaaagga
attgagaaaacaggaaggttcaacattctctccaaagatgtaggagtgccacttgtagcc
ttcacattgaaagacagtagccatcacaccgtgttcgagatagccgaccatttaagaaaa
tatggttggatagttccggcctatacaatgccggcagacgctcaacacatcgccgtcctc
cgagttgtgattagggaggatttcagctgtagcttggctgagagacttgtgtctgacata
gacaaagttgttaaacacttggacacacttccaagcactgtctccattaaaagtgctcat
gtcacagctagtactagtgaggatagtgagaaagttaagaaagatgttaaagagagtcat
gatgcgattacaaagtattggaagaagcttgtggatggaaagacagttggaacatgctag

DBGET integrated database retrieval system