KEGG   Cicer arietinum (chickpea): 101508066Help
Entry
101508066         CDS       T02819                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00052  Galactose metabolism
cam00500  Starch and sucrose metabolism
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101508066
   00500 Starch and sucrose metabolism
    101508066
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101508066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101508066
NCBI-ProteinID: XP_004486491
UniProt: A0A1S2XAU6
LinkDB All DBs
Position
Ca1
AA seq 908 aa AA seqDB search
MTTIASRTKTRTIPLPLLPFCFIICLILHKTVADSQVGYGYTITTVNNDPTKTSLTSNLK
LIKPSFVFGPDIPFLNLVASFETKDRLRVRITDSNNQRWEIPQKVIPRESSFSSLSYPFQ
QNPQNSKNFLLTHPNSDLIFTLHNTTPFGFTVSRKSSKDILFNTLPEDPLNPETFLVFKE
QYLQLSSSLPIKRASLYGFGEHTKNSFKLQPNTSFTLWNKDVGSSNVDVNLYGSHPFYLD
VRSGSSDGRVKSGTTHGVLLLNSNGMDVVYSGDRVTYKVIGGVFDLYFFAGSSPELVLEQ
YTELIGRPAPMPYWSFGFHQCRWGYKNVSDVQGVVTNYAKAGIPLEVMWTDIDYMDAYKD
FTLDPVNFPLDKMRNFVDTLHQNGQKYVLILDPGISVNETYATYIRGLKADIYIKRNGVN
YLGEVWPGKVYYPDFLNPHSQEFWSGEIKLFMDILPFDGLWLDMNELSNFITSPDIPHSN
LDNPPYKINSSGIQRPINEKTVPATSLHYGNITEYDSHNLYGLLESKATNKALVDITGKR
PFILSRSTFVSSGKYTAHWTGDNAATWNDLAYSIPSILNFGIFGVPMVGADICGFSGNTT
EELCRRWIQLGAFYPFARDHSDKSSTRQELYLWESVASSARKVLGLRYCLLPYFYTLMYE
SNTKGTPIARPLFFSFPEDVTTYEINSQFLLGKGVLVSPVLQSGAVTVNAYFPSGNWFDL
FNLSNSVNAESGKHVTLDAPFDHINVHVGEGNILALQGEAMTTEAARKTAFELVVVISSN
GNSYGQVYLDDGEGLDIEGEKDQWTLVRFYGALNNDSVSVTSNVTNGKFALDKKWIIEKV
TFLGIPKHERLNRIDMAESELSIVNGMSLIKKTVVMTKFDSSSKFVIVEVSNLSQLIGEE
FKLETEIK
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgactactatagcttcgagaactaaaaccagaaccattccactaccactactacccttc
tgtttcattatttgtctcatcttacacaaaaccgttgcagattcacaagttggttatggc
tacacaatcacaactgtaaacaatgatcctacaaaaacatctttgacttctaaccttaaa
ctcatcaaaccctcctttgtttttggacccgacattccattcctcaacctcgttgccagt
tttgagactaaggatagattaagagtaagaataactgattcaaacaaccaaagatgggaa
attccacaaaaagtgattccaagagaatcatcattttcctcactatcttacccttttcag
cagaatccacaaaactcaaaaaacttcttactcacacatccaaattcagatcttatcttc
acactccacaacaccaccccatttggtttcactgtttcacgcaaatcctccaaagatata
ctctttaacactttaccagaagaccctttaaaccctgaaacgtttctagtgtttaaagaa
caatacttgcaactttcttcttctctgcctataaaaagagcttctttgtatggttttggg
gagcatacaaagaattccttcaagttgcaaccaaacacaagtttcactctttggaataaa
gatgttggaagttccaatgttgatgtgaacctttatggatctcaccctttttatttggat
gtgaggtcgggttcatctgatggaagagtgaaaagtgggaccacgcatggtgttttgctt
cttaatagtaatggaatggatgttgtttatagtggtgatcgtgttacttataaggtgatt
ggtggtgtttttgatttgtacttttttgctggttcatcgcctgaattggttttggaacag
tatactgaactcattggtaggcctgctccaatgccttattggtcttttggttttcatcag
tgtagatggggctacaagaatgtaagtgatgtccagggtgtggtaaccaactatgcaaaa
gctggtataccccttgaagttatgtggacagatattgattacatggatgcatataaagat
tttacactagatcctgttaattttccacttgataagatgagaaattttgttgacaccctt
caccaaaatggtcagaaatatgtgcttatcttggatcccggtatcagtgtaaatgagaca
tatgccacctatattagaggtttgaaggctgatatctatataaagagaaatggtgtcaac
tatctaggtgaagtttggcctggaaaagtttactaccctgattttcttaaccctcatagc
caagaattttggagtggagaaatcaaattatttatggacattctcccttttgatggtctt
tggcttgatatgaatgagttatcaaatttcataacttctcctgacattccacattctaac
cttgataaccctccctacaaaattaacagtagtggcattcaacgaccgattaatgaaaaa
acagtgccagcaacatctttacattatggtaatatcactgagtatgattcacacaattta
tatggactactagaatccaaagcaactaataaggccttagttgatataactggtaaaagg
ccattcattttgagtagatcaacttttgtaagctcgggtaagtatacagctcattggact
ggagataatgctgctacatggaatgatttggcatactcaattccatccatattgaacttt
ggaatctttggagttcctatggttggagcagatatatgtggcttctctggcaacacaact
gaagaactttgccggcgctggatccagttgggggccttttacccctttgcaagagatcat
tcagacaaaagctcgacccggcaagagctatacctatgggaatcagttgcttcatcagca
aggaaagtgctcggccttcgttactgccttcttccttatttctacacactaatgtatgaa
tcaaatacaaaaggcacaccaattgcaagacctcttttcttttcgttccctgaagatgtc
acaacatatgaaataaactctcagtttctattaggcaaaggtgttctagtctcacctgtg
ctacaatccggcgcagtcaccgtcaatgcatattttccttcaggaaattggtttgatcta
tttaatctctcaaattcagtgaatgcagaatcaggcaaacatgtcacacttgatgcacca
tttgatcacataaatgtgcatgttggtgaaggtaacattttggccttacaaggtgaagca
atgaccactgaagctgctagaaaaactgcatttgaacttgtggttgtgattagtagcaat
gggaatagttatggacaagtgtatttagatgatggtgagggtcttgacattgaaggagag
aaagatcaatggacacttgtgagattttatggtgcattgaacaatgatagtgtttctgtt
acatctaatgtgactaatggaaaatttgctttggataaaaaatggattatagaaaaggtt
actttcttggggatacctaagcatgagagattaaataggattgatatggctgagagtgag
ttgagtattgtgaatggaatgagtttaataaaaaaaactgttgtgatgacgaaatttgat
agctcttctaagtttgttattgtggaagtttcaaatttgtcacagcttattggagaggaa
tttaagcttgagactgaaataaagtag

DBGET integrated database retrieval system