KEGG   Cicer arietinum (chickpea): 101509971Help
Entry
101509971         CDS       T02819                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam03030  DNA replication
cam03410  Base excision repair
cam03420  Nucleotide excision repair
cam03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cam00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101509971
   03410 Base excision repair
    101509971
   03420 Nucleotide excision repair
    101509971
   03430 Mismatch repair
    101509971
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cam03032]
    101509971
   03400 DNA repair and recombination proteins [BR:cam03400]
    101509971
Enzymes [BR:cam01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101509971
    6.5.1.6  DNA ligase (ATP or NAD+)
     101509971
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101509971
DNA replication proteins [BR:cam03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101509971
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101509971
DNA repair and recombination proteins [BR:cam03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101509971
   NER (nucleotide excision repair)
    Other NER factors
     101509971
   MMR (mismatch exicision repair)
    Other MMR factors
     101509971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 101509971
NCBI-ProteinID: XP_004506069
UniProt: A0A1S2YKA4
LinkDB All DBs
Position
Ca6
AA seq 774 aa AA seqDB search
MLAFHFKPCFSLPLSFRISLKPPSLDFSFPRLIMSKPPPSAFDALMSGARAAASKKKPLP
ISSSPKKRKTPPPPPSASPSTLPQNPNNLKTPETLQTVQKPQEIAQPEPPNKIRNTSSSL
SSKEIIAELKERVPNLKKKPSDFNPSSVACWGKDKPVPFLFLCLAFDLISEETGRIVMTD
IVCNLLRTVIQSTPEDLVPVVYLSANRIAPAHEGLELGIGDASIIKALAEACGRTEQQIK
IQYKDKGDLGLVAKASRSSQSMMRKPDALTIRKVFNTFRLIAKESGNNSQEKKKNHIKSL
LVAATDCEPLYIIRLLQTKLRIGYAEQTLLAALGQAAVYTEEHSKPPLGIQSPFEEAAKI
VKKVYSVLPDYDKMLSALLTDGVWELPNKCNFTPGVPVGPMLSKATKGVSEILDKFQDVE
FTCEYKYDGERAQIHYLEDGSVEIYSRNAERNTGKFPDVVAAVSRLKKTLVSSFILDCEL
VAYDRAKQRILPFQVLSTRARKNVALSDIKVEVCIFAFDMLYLNGKALLQENLKIRREHL
YASFEEESGFLQFATSITSNDIEEIQRFLDEAVDGSCEGLIIKTLNEDATYEPSKRSLNW
LKLKKDYMENIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDNDNEEFQSICKIGTGFSE
EVLEERSTSLRSKVIPKPKSYYQYGEAIKPDVWFDASEVWEVKAADLTISPVYRAAVGTV
HSDKGISLRFPRLVRVRPDKAPEQASSSEQVAEMYKAQKHNHNHNGNMDDNEDD
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcattccatttcaaaccctgcttctctcttcccttatctttccgcatttccctt
aaacccccttctctcgatttctcattccctcgcctcattatgtcaaagcctcctccctcc
gccttcgacgctctcatgtctggcgcacgcgccgccgcctccaaaaagaaacccctcccc
atttcctcatctcccaaaaaaagaaaaacccctccccctcccccttccgcttctccatcc
actctcccccaaaaccctaacaacctcaaaacccccgaaaccctccaaaccgttcaaaaa
cctcaagagatcgctcagccagaaccaccgaacaagatccgcaacacgtcatcttcactt
tcttcgaaggagattattgccgaattaaaggaacgagttccgaatctgaagaaaaaaccc
tctgatttcaatcccagctccgttgcttgctgggggaaagacaaacctgtaccgttcctt
ttcctatgcttggcgttcgacttgatttcggaagagaccggaaggattgtgatgactgac
attgtgtgcaatctattgaggacagtgattcagtctacaccggaggatcttgttcccgtt
gtttatctttctgctaacagaattgctcctgcgcatgaagggttagaattgggaatcgga
gatgcttctattattaaggcgctcgccgaggcgtgtggaaggactgaacaacagattaaa
attcagtataaggataaaggtgacttgggtttggttgctaaagctagccgttcttcacag
tctatgatgcggaagcctgatgctttgactattaggaaggttttcaacacctttcgtctt
attgcaaaggaatctggaaataacagtcaagagaagaaaaagaatcacataaagtcactt
cttgttgctgcaactgattgtgaacctctatatataatccgtttgctacagaccaagttg
cgaattggatatgctgagcaaactcttttagctgcattaggccaagctgcagtgtacact
gaagaacattctaaaccgcctcttggaattcagtctccttttgaagaggctgcaaagatt
gttaaaaaagtctactctgttcttcctgactatgacaaaatgttgtctgcactgcttacg
gatggtgtatgggaacttccaaacaaatgtaattttactcctggtgttcctgttgggcct
atgttgtcaaaagcaaccaagggtgtatctgaaattttagataagttccaggatgtggag
tttacatgtgaatacaaatacgatggagagcgtgctcagatacattacttggaggatggc
tcggttgagatttacagtagaaatgctgaacggaatactgggaagtttcctgatgttgtt
gctgcagtttcaaggttaaagaaaacattggtatcatcatttattcttgattgtgaactt
gttgcatatgatcgtgcaaaacagagaatccttcctttccaggtgcttagtactcgggcc
cgcaaaaatgtagctttgagtgacataaaagttgaagtttgcatatttgctttcgatatg
ttgtaccttaatggtaaagcacttcttcaggaaaacctgaaaatccgtagagagcatctc
tatgcttcttttgaggaagaatctggattccttcagtttgcaacatcaataacatcaaat
gatattgaggaaatacagagatttcttgatgaagctgttgatggaagttgtgagggatta
attattaaaacattaaatgaagatgctacatatgaaccctccaagcggtcgctcaactgg
ctgaaactgaagaaagattatatggaaaatataggggattcactagatttggtgcctatt
gctgctttccacggtcgtgggaaacgtacaggagtctacggtgcctttctccttgcttgc
tatgacaatgataatgaagaatttcaaagtatttgtaagataggaactggattctctgaa
gaagtgcttgaagaacgttctactagccttcgctctaaagtgattcccaaaccaaagtca
tattatcaatatggagaagcaatcaaaccggatgtttggtttgatgccagcgaggtgtgg
gaggtgaaagctgcagacctgaccattagccctgtttaccgagctgcagttggcacagta
cattccgataagggcatatctcttcgatttccgcgtctagtacgagttcggcctgacaaa
gctcctgaacaggcctcatcgtctgagcaggttgctgaaatgtataaagctcaaaaacat
aatcataatcacaacggcaacatggatgacaatgaagatgattga

DBGET integrated database retrieval system