KEGG   Cicer arietinum (chickpea): 101510154Help
Entry
101510154         CDS       T02819                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cam03036]
    101510154
Enzymes [BR:cam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101510154
Chromosome and associated proteins [BR:cam03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     101510154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101510154
NCBI-ProteinID: XP_004498908
UniProt: A0A1S2Y3W6
LinkDB All DBs
Position
Ca4
AA seq 350 aa AA seqDB search
MSSSSSFSPANDAVMRNRILSTNLYFDIPPFKVPLIYSNSYDVSFLGIEKLHPFDSSKWG
RICRFLVSFGVLDKKCIVEPLEASKDDLLVVHSESYLNSLKESSNVAKIIEVPPVAFFPN
CLVQHKVLFPFRKQVGGTILAAKLAKERGWAINVGGGFHHCSAEKGGGFCAYADISLCIH
FAFVQLNISRVMIIDLDAHQGNGHEMDFADDSRVYILDMYNPGIYPLDYEARNYINQKVE
VKSGTRTEEYLQKLDEALEVAGRRFNPELLVYNAGTDILEGDPLGRLKISPDGIALRDEK
VFRFAREKNIPIVMLTSGGYMKSSARVIADSIVNLEKKCLIETRGNPKTA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgtcttcttctttttctcccgctaacgatgctgttatgcgcaaccgcatcctc
tctaccaacctctacttcgatatccctccgttcaaagttccgcttatctactccaattct
tacgatgtatcctttctcggcatagagaaactgcatccttttgattcgtccaaatgggga
cgaatttgtcgcttccttgtttcttttggtgttctggataaaaagtgtattgttgagcct
cttgaagcttctaaagatgaccttctagtggtacactcagaatcatacttgaatagtttg
aaggaaagttcgaatgttgccaagataattgaggtccctcctgtggcattttttcccaat
tgtcttgtgcaacataaagttcttttcccatttaggaaacaggttggaggaactatattg
gctgcaaaacttgcaaaggagagaggatgggccattaatgtgggaggtggttttcatcac
tgctctgcagaaaaaggaggtggattttgtgcctacgcagatatttctctatgcatccac
tttgcttttgttcagttgaatatatcaagggtgatgattattgatcttgatgcacatcaa
ggaaatggtcatgaaatggacttcgccgatgatagccgagtctatattctggatatgtat
aaccctggaatttatcctttggattatgaagcaagaaattacataaatcagaaagttgaa
gtaaagagcgggacccgtacagaagagtacctgcagaaactagatgaagcactcgaggtt
gctgggcgaaggtttaaccctgaattgttagtttataatgctggaactgacattctagaa
ggtgacccattaggaaggttgaagattagtcccgacggaattgctcttagagatgagaaa
gtttttcggtttgctcgtgagaagaacattcctattgtcatgctcacttcaggtggatac
atgaagtccagtgctagagtcattgcagattcaatagtcaatctcgagaagaaatgcttg
atagaaacgagaggaaatccaaagactgcataa

DBGET integrated database retrieval system