KEGG   Cicer arietinum (chickpea): 101512334Help
Entry
101512334         CDS       T02819                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101512334
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101512334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101512334
NCBI-ProteinID: XP_004506078
UniProt: A0A1S2YKP6
LinkDB All DBs
Position
Ca6
AA seq 207 aa AA seqDB search
MQIAMASSQTLVSPSPLSSQTLLRSSFSGVSLKLSPQFPTLSPSNFKPLTVVAAAKKAVA
VLKGNSAVEGVVTLSQEDDGPTTVNVRITGLTPGLHGFHLHEYGDTTNGCISTGAHFNPK
KLTHGAPEDEIRHAGDLGNIVANADGVAETTIVDNQIPLTGPNSVVGRALVVHELQDDLG
KGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcagatagcaatggcttcttcccaaactctcgtttcaccttcaccactctcttctcaa
actcttctccgatcatccttctccggcgtatctcttaagctctctccccaatttccaact
ctttcaccctcaaatttcaagcctctcactgtcgttgctgctgccaagaaagccgtcgcc
gttctaaagggtaactctgctgtcgaaggtgtcgttactctcagtcaagaagatgacggt
ccaacaacagttaatgttcgcatcactggccttactccagggcttcatggttttcacctt
catgagtatggtgatactacaaatgggtgtatctcgacgggagcacattttaatcctaaa
aaattgactcatggtgctcctgaggatgaaatccgtcatgcgggtgacctgggaaacata
gttgctaatgccgatggcgttgcagagacaacaatcgttgacaatcagataccactcact
ggccccaattcagtcgttgggagagccttagtggttcatgaacttcaagatgaccttgga
aaaggtggacatgaacttagtttgaccactggaaatgctggtggaagattagcttgtggt
gtggttggcttgactccaatataa

DBGET integrated database retrieval system