KEGG   Cicer arietinum (chickpea): 101513215Help
Entry
101513215         CDS       T02819                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00020  Citrate cycle (TCA cycle)
cam00190  Oxidative phosphorylation
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
cam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101513215
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101513215
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101513215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 101513215
NCBI-ProteinID: XP_004509252
UniProt: A0A1S2YSM2
LinkDB All DBs
Position
Ca7
AA seq 627 aa AA seqDB search
MWRFVSRTISERSNPNLQPLRSHFSRFFSSGGNSSYNVVDHKYDAVVVGAGGAGLRAAIG
LSEHGFNTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI
QYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLNFGKGGQAYRCACAADRTGHA
LLHTLYGQAMRHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQAASTILATGG
YGRAYFSATSAHTCTGDGSAMVARAGIPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGIL
RNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPMKDHIYLHLNHLPPDVLKE
RLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTPKGDNPDEIVPGLMA
AGETACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGMKTISWLD
KLRNSNGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEGCQLIDGAWESFRDVKLEDRSLI
WNSDLIETIELENLLINASITVHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK
VRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtttcgtgtctcgtactatttccgagagatccaatcctaatcttcaaccactt
agatctcacttttcaagatttttctccagtggtggaaactcgtcgtacaatgtggtggat
cataagtacgacgccgttgttgttggtgctggtggtgcagggttgagagctgctattgga
ctttcggaacatggcttcaatactgcttgcgttacaaagctatttccaactcgttcgcat
actgttgcagctcagggaggtataaatgctgcattgggaaatatgactgaagatgactgg
aggtggcacatgtacgacactgtcaaaggaagtgattggctaggagaccaagatgccatc
caatatatgtgtagggaggcaccgaaagcagtcattgagcttgagaattatggattgcca
ttttcccgaactgaagatggaagaatataccagcgagcatttggtggtcaaagcttgaac
ttcggaaaaggtggtcaggcatatcgttgtgcatgtgctgccgatcgaacagggcatgct
ttactacacactctctatggccaggctatgaggcataatacccagttttttgtggaatac
tttgcgctggatctattaatgaacagtgatggtagttgccaaggagtaattgcgttgaat
atggaggatggaacattacatcgtttccaagctgcttcaacaattttggctactgggggt
tatggtagagcatacttttctgcaacttcggcacatacatgcactggagatggcagtgcc
atggttgctcgtgctggaatcccacttgaggatttagagtttgtgcaatttcacccaaca
ggtatatatggagctggttgccttatcacagaagggtctcgtggtgaaggtggaattctt
aggaacagcgaaggtgagaggtttatggaacggtatgctcctactgcgaaggatctcgca
tcaagagatgtagtttcaagatcaatgactatggagattcgggaaggccgtggtgtagga
ccaatgaaagatcacatctatctccacttgaatcacttacccccagatgtgctcaaggag
agactacccggtatatctgaaactgctgctatttttgccggtgtggatgttacaaaggaa
cccattcctgttttaccaactgtgcattataacatgggtggtatccccactaattatcat
ggagaggtggttacccctaaaggtgacaatccagatgaaatagttcctggtttaatggct
gctggggaaacagcctgtgcatcagtccatggtgccaatagactcggtgcaaattcactt
ctggacattgttgtctttggtagagcttgtgcaaacagagttgcagaaatccaaaggcca
ggagagaaacaaaagcctttagagaaagatgctgggatgaagacaatttcttggcttgac
aaattgagaaattcaaatgggtcattgccaacctcaaaaatcaggttgaatatgcaacga
ataatgcaaaacaatgctgctgtattccgcacacaagaaacattagaagaaggttgtcaa
ttgattgatggagcatgggagagctttcgtgatgtcaagttagaggatcggagcttgata
tggaactctgacctgattgagactattgagttggaaaatcttttgataaatgcctccatt
accgtgcactctgctgaagccagaaaagagagcagaggtgctcatgcccgcgaagacttc
acgaaaagagatgatgagaaatggatgaaacacacattgggatattgggaaaacgagaag
gtccgtttagattacaggccggtacacatgaatactttggatgatgaggttgaatcattc
cctcctaaagcgcgtgtctattaa

DBGET integrated database retrieval system