KEGG   Cicer arietinum (chickpea): 101514533Help
Entry
101514533         CDS       T02819                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101514533
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cam03036]
    101514533
Enzymes [BR:cam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101514533
Chromosome and associated proteins [BR:cam03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101514533
   Polycomb group proteins
    PRC2-EZH2 complex
     101514533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 101514533
NCBI-ProteinID: XP_004511910
UniProt: A0A1S2YYF5
LinkDB All DBs
Position
Ca8
AA seq 863 aa AA seqDB search
MASMPPPLPSPSSSRSEPHLDPFTKKVEEDTSPAVQDVLSAIDSLKKQVVAERIVTVKKR
VEENRQKLVGITNCLWKSAAERRTCGVADTIRSLDLLTKRQKDAVDMHNGVCGGNDDKES
NGYHGDDHGSTAVLLGSNVAVKNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGR
RRIYYDQNGGEALICSDSEEEIIDEEEEKREFVQSEDFILRMTIREFGLSDAVSETLAQC
FSRKASDIKARYETLCNDDNAGGDSKNGDIEDNSQSDNSFLEKDLEAALDSFDNLFCRRC
RVFDCRLHGCSQDLVFPAERQTLWIPPNTENAPCGPNCFRSVLKSEKFAKVTSSQTDVED
KSSGGALSRKKNSGRRLIKCSQSESASSNAKNISESSDSENGPGRDAVSASRSAPPKTKP
VGKSGVGKRNSKRVAERVLVCMQKRQKKTVASDSDSKSEAHDHSLNDMVSDPHVVTEEDN
TRKEEFVDENICKQELTDNKSWKALEKGLLEKGMEIFGKNSCLIARNLLNGLKTCWDVFQ
YINCEEGKLSGSTGDATNALVEGYSKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIR
KRITERKDQPCRQYNPCGCQTACGKQCSCLQNGTCCEKYCGCPKSCKNRFRGCHCAKSQC
RSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQKVLLGR
SDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAY
RKGDKLKFANHSPVPNCYAKVIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAR
KPEASGSKKDDNAPSSGRAKKLA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatgcctccgcctctgccttcgccgtcttcgtctagatccgagcctcatctc
gatcccttcacaaagaaagtggaggaagacacaagtcctgcagttcaagatgtgttatcg
gctattgattctttaaagaaacaagttgttgctgaacggattgttaccgtcaagaaaaga
gtggaggaaaatagacagaagctggttggtatcaccaactgtctctggaaatcggcggcg
gagagaaggacatgtggtgttgccgatacgattagaagtcttgacctgctgactaagagg
caaaaagatgcagttgatatgcacaacggtgtttgtggtggtaacgatgataaggagagc
aatggctatcatggagacgaccatggttctacggcagttcttctaggatctaatgttgct
gtaaagaatgctgttcggcctatcaaattacccgaagttaaaagattgcctccttacact
acatggatttttctggacagaaatcaaagaatgacagaggatcaatcagttgtaggtcgg
aggcgaatttattatgatcaaaatggtggagaagcactcatttgcagtgacagtgaggag
gaaataattgatgaagaagaggaaaaaagagaatttgtacaatcagaagattttatactt
cgcatgactatcagagaatttggtttatctgatgctgtttcagagacactggctcagtgt
ttttctagaaaagctagtgacattaaggcccgatatgaaactctttgcaatgatgacaat
gctggcggggattctaaaaatggggatatagaagataattcccaaagtgacaattctttt
ctggaaaaggatcttgaagcagctcttgactcttttgacaacctcttttgtcgccgttgt
cgtgttttcgattgcagattacatggatgctctcaggatcttgtcttcccagctgagaga
caaactttgtggatccctcctaacaccgaaaatgcaccatgtggaccaaattgtttcaga
tcggtacttaagtccgaaaaatttgccaaagttacatcttctcagactgatgttgaagac
aaatcttctggtggtgctctatctaggaaaaaaaattctggtagaaggctgataaaatgc
agccaaagtgaaagtgcttcatctaatgctaagaacatatctgagagtagtgactcagag
aatggtcctgggcgggatgctgtttcagcctcccgctcggccccacctaaaactaaacca
gtggggaaaagtggagttggtaagagaaacagtaagagagtggcagaacgtgttctagtt
tgcatgcagaaacggcagaagaaaacagtagcttctgattctgattccaaaagtgaagct
catgaccactcattgaatgatatggtatcggatccacatgttgtgaccgaggaagacaac
acgaggaaagaagagtttgtggatgagaacatttgtaaacaagaattgacagataataaa
tcttggaaagctcttgaaaaaggtcttttagaaaaaggaatggaaatttttggcaaaaac
agctgcttaatagccaggaatctcttaaatggtcttaagacatgttgggatgttttccaa
tacataaattgtgaagaagggaagttgtctggttctactggggatgctacgaatgctctc
gtggaaggctattccaagggtaataatgaagtgagaagaaggtcaagatttttacgtaga
agaggaagagtccgtcgtttgaagtatacctggaaatctgccgcttatcattcaataaga
aaaaggattactgagagaaaggatcagccctgccgacagtacaatccgtgtggatgccaa
acagcttgtggaaagcagtgttcgtgtcttcaaaacggaacctgctgtgagaagtactgt
ggatgcccaaagagttgtaaaaatcgattccgtggatgtcattgtgcaaagagtcaatgc
cgaagtcgtcaatgtccatgctttgctgcagatagggaatgcgatccagatgtttgtagg
aactgttgggtcagctgtggcgatggtactcttgggattcctagtcaaagaggggataat
tatgaatgtagaaacatgaagcttcttctcaaacaacaacagaaggttcttcttggaagg
tctgatgtgtctggctggggagccttcttaaagaatagtgttggtaagcatgaatacctt
ggagagtatactggagaattaatttctcatagggaagcagataaacgaggaaagatatat
gaccgtgaaaattcatcttttctctttaatctgaatgatcagtttgttcttgatgcttat
cgaaagggtgataaattgaagtttgcgaaccactctcctgttccaaattgttatgcaaag
gttattatggttgctggagatcatagggtaggaatttttgccaaggaacggattaacgct
ggggaggagctattttatgattaccgttatgagccagatagagctcctgcttgggctcgg
aagcctgaggcatctggatcgaaaaaagatgacaatgctccttcaagtggtcgtgcaaag
aagcttgcttaa

DBGET integrated database retrieval system