KEGG   Cicer arietinum (chickpea): 101514970Help
Entry
101514970         CDS       T02819                                 

Definition
(RefSeq) glutathione S-transferase U19-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101514970
Enzymes [BR:cam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101514970
Transporters [BR:cam02000]
 Other Transporters
  Pores ion channels [TC:1]
   101514970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_3 GST_C_5 GST_C_6 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 101514970
NCBI-ProteinID: XP_004490778
UniProt: A0A1S2XKL9
LinkDB All DBs
Position
Ca2
AA seq 221 aa AA seqDB search
MSKGDKVVVLDFWASPFCARVKIALEEKGVDHVDNEEDIFGKKSELLLKSNPIHQKVPVL
LHNDKPVLESSIIVSYIDHVWSSNSLLPDNAYDLAKATFWADFIDKKVFETGRSIWASNG
EEREVGTRDFIEVLKHLEEALGEKKYFGGDAFGYVDIIAIPHSAWFLAYETLGGFKIEDH
SPKISAWIKRCLQRDSVKNVLPDPEKVYQFVLHFRKMSGLE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagggagacaaggttgttgttttggacttttgggctagcccattttgtgcaaga
gtgaaaattgctttggaagagaaaggtgtggatcatgtggacaatgaagaggatatattt
ggaaaaaaaagtgagcttcttctaaagtcaaatccaattcaccaaaaagtacctgttctc
ttgcataatgacaaacctgtccttgagtcttctatcattgttagctatattgatcatgtt
tggtcttccaactcattgcttccagataatgcatatgatcttgccaaagctacattttgg
gctgatttcattgacaaaaaggtgtttgaaactggaaggagcatttgggctagcaatgga
gaagaaagagaagttggaacaagagacttcattgaagttttaaagcatctagaagaagct
cttggagagaaaaagtactttggtggtgatgcatttggttatgtagacatcatagccatt
cctcattctgcatggtttttagcatatgaaacacttggtggtttcaaaattgaagatcat
agtccaaaaatttcagcttggattaaaagatgcttgcaaagagactctgtgaaaaatgtt
ctgcctgaccctgaaaaggtttaccaatttgtccttcattttaggaagatgtcaggactt
gaatga

DBGET integrated database retrieval system