KEGG   Cicer arietinum (chickpea): 105851390Help
Entry
105851390         CDS       T02819                                 

Definition
(RefSeq) ribonuclease II, chloroplastic/mitochondrial-like
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cam03016]
    105851390
Enzymes [BR:cam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     105851390
Transfer RNA biogenesis [BR:cam03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    105851390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTPS FtsJ
Motif
Other DBs
NCBI-GeneID: 105851390
NCBI-ProteinID: XP_012567629
LinkDB All DBs
Position
Un
AA seq 157 aa AA seqDB search
MERRIGWFQIRFLLKQHNANGVTSSMKLQQVTYIVPGIDNFDQANIAGFVHKAQENMDPS
LLELAWSELLENNKTVTVEDMAEIIFGRVEPLESYSAHLLLSEVEVYFTVLETKGVHCIY
GPRPSEQFKNSVTTIIKWIVLYISATIPQVTTTSHLF
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaagaattggatggtttcagatcaggttcttgttgaaacagcataatgcgaat
ggcgtcactagttccatgaagctgcaacaagtgacatatattgtacctggtattgacaat
tttgaccaagcaaatattgctggtttcgttcataaagctcaggaaaacatggacccatcg
ctacttgaacttgcttggtctgagctacttgaaaataataagactgtgaccgttgaagat
atggctgagataatttttggtcgtgttgagcctcttgagagttattctgctcatctattg
ctatcagaagttgaggtatactttactgtgctagagacaaaaggagtgcattgcatttat
ggacctcgacctagtgagcagttcaagaattcggtcaccaccatcatcaaatggatcgtc
ttgtacatctccgctactatcccacaggtcacaaccacgtctcacttattttaa

DBGET integrated database retrieval system