KEGG   Cicer arietinum (chickpea): 105851841Help
Entry
105851841         CDS       T02819                                 

Gene name
sod-1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105851841 (sod-1)
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105851841 (sod-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu GRDA
Motif
Other DBs
NCBI-GeneID: 105851841
NCBI-ProteinID: NP_001296637
UniProt: Q9ZNQ4
LinkDB All DBs
Position
Ca3
AA seq 152 aa AA seqDB search
MVKAVAVLGSSDTVSGTINFSQEGDGPTTVTGNLAGLKPGLHGFHIHALGDTTNGCISTG
PHFNPNGKEHGSPEDPIRHAGDLGNINVGDDGTVSFSITDNQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggctgtggcagttcttggtagcagtgacactgtgtctgggactattaacttc
agtcaggagggagacggtccaaccactgtaactgggaatcttgctggtcttaagcctggt
ctccatggcttccatattcatgccttaggggacaccacaaatggctgcatatcaaccgga
ccacatttcaatcctaatgggaaagaacatggttcccctgaggacccgattcgacatgct
ggcgatttaggaaatatcaatgtcggtgatgatggaactgtaagcttctctattactgac
aatcagatccctctcactggaccaaactccatcataggaagggctgttgttgttcatgct
gatcctgatgatcttgggaaaggtggtcacgagcttagcaaaactactggaaatgctggc
ggcagagtagcttgtggtattattgggttgcaaggataa

DBGET integrated database retrieval system