KEGG   Citrobacter amalonaticus Y19: F384_01570Help
Entry
F384_01570        CDS       T03934                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00473  D-Alanine metabolism
cama00550  Peptidoglycan biosynthesis
cama01100  Metabolic pathways
cama01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    F384_01570
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F384_01570
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    F384_01570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cama01011]
    F384_01570
Enzymes [BR:cama01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     F384_01570
Peptidoglycan biosynthesis and degradation proteins [BR:cama01011]
 Precursor biosynthesis
  Amino acid ligase
   F384_01570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK GARS_A NHase_alpha
Motif
Other DBs
NCBI-ProteinID: AKE57921
UniProt: A0A0F6TT67
LinkDB All DBs
Position
complement(357640..358734)
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGQWHVSDANNYLLN
ANDPAHIALRPSATSLAQVPGRHEQQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFITLTRANRNTISFAEVEARLGL
PLFVKPANQGSSVGVSKVTSAAQYAQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIEPQINDKIREIAIQAYQTLGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggaatcgtatttggtggtaaatcagcggagcatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagacccgctttgacgtcgtgttg
ttaggcattgataagcaagggcagtggcacgtcagcgatgccaacaattacctgctcaat
gcgaacgatccggcgcatattgcgctgcgtccttctgcgaccagcctggcacaggttccg
ggtaggcatgagcagcagttgattgatgcgcagaatggccagccgctgccgaccgtggac
gtcattttcccgattgtgcacggcacgctgggcgaggatggttcactgcaaggaatgctg
cgcgtggcaaatctgcccttcgtcggttccgacgtactgggctctgcggcgtgcatggat
aaagacgtcactaagcggttgttgcgtgatgccggactgaatatcgcgccgtttattacg
ctgacgcgcgccaaccgcaatacgataagttttgcagaggtagaagcccgtcttggcctg
ccgctgttcgttaagcccgctaatcagggatcgtctgtcggcgtcagtaaggtcaccagc
gcagcgcaatacgcgcaggctgtcgccctcgcgttcgaattcgatcacaaagtggtggtg
gagcaagggatcaaagggcgtgagatcgagtgcgcggtgttgggcaacgatcatccgcag
gccagcacctgtggcgagatcgtgctcaacagtgatttctatgcctacgacaccaaatac
attgatgataatggcgcgaaagtggtggtccctgcggcgattgagcctcagatcaacgac
aaaatccgtgagattgccattcaggcgtatcagacgctgggctgcgccggcatggcgcgc
gtcgatgtcttcttaacggccgataatgaggtggtgatcaatgagatcaacaccctgcca
ggctttaccaacatcagcatgtatccgaaactctggcaggccagcggtttaggctatacc
gatttgatcacccgcttgatcgaactggcgctggaacgtcacgctgcggataacgcgctg
aaaacaacgatgtaa

DBGET integrated database retrieval system