KEGG   Citrobacter amalonaticus Y19: F384_01590Help
Entry
F384_01590        CDS       T03934                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00730  Thiamine metabolism
cama00790  Folate biosynthesis
cama01100  Metabolic pathways
cama02020  Two-component system
Module
cama_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    F384_01590
   00790 Folate biosynthesis
    F384_01590
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F384_01590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cama04147]
    F384_01590
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cama00537]
    F384_01590
Enzymes [BR:cama01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     F384_01590
Exosome [BR:cama04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F384_01590
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cama00537]
 Enzymes
  F384_01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AKE57925
UniProt: A0A0F6RDS4
LinkDB All DBs
Position
361506..362921
Genome map
AA seq 471 aa AA seqDB search
MKQSAIALALLPLLYIPVSHSETSSMSVLDNRAAQGDITTPGGARRLSADQTQALRESLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGYFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHTTLLEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAEARGYQLVGDAASLAVIGEASQDKPLLGLFSDGNMPVRWEGPKASYHGN
IDKPVVTCTPNPKRDETVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKKEGNTLVIVTADHAHASQIVAPETKAPGLTQALNTKDGAVM
VISYGNSEEESQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcgctatcgctcttgcattgttaccgctgctgtatatccctgttagtcat
tctgaaacatcatccatgtcggttctggacaaccgtgccgcgcaaggggatattacaacg
ccaggcggagcacgccgtttatcggccgatcaaacacaagcattgcgcgaatcactgaat
gataaacccgcaaaaaatattattttattgattggcgatggtatgggcgattcagaaatt
accgctgcgcgaaattatgctgaaggcgcgggtggttattttaaagggattgatgcctta
ccgctgaccggccaatacacgcactatgcgctggataaaaaaaccggtaagccagattac
gtgacagactccgctgcgtcggcaaccgcatggacaaccggtgtgaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacacgacgctgctggaaatggcaaaagcg
gcggggctggcgacgggcaacgtctcgaccgcagagctacaggatgctacgcctgccgcg
ctggtggcgcacgtcacgtcacgtaaatgctatggcccgagcgtaacgagcgagaaatgc
ccgacgaatgcgctggaaaaaggcggcaaaggctcaataaccgaacaactgctgaatgcc
cgtgcggatgtgacgctgggcggcggcgcgaaaacattcgccgaaaccgcgacagcgggc
gaatggcagggcaaaacgctgcgtgaacaggccgaagcccggggctaccaactggtcggc
gacgcggcctcactggcggtaatcggcgaagccagtcaggacaaaccgctgctgggactg
ttctctgacggcaacatgcctgtgcgctgggaaggccccaaagcgtcttatcacggcaat
attgataagccagtcgtgacctgtacaccgaatccaaaacgcgacgagaccgtcccgacg
ctggcgcaaatgactgacaaagccattgagctgctcagcaaaaatgagaagggattcttc
ctgcaggtggaaggggcttctatcgataaacaggatcacgcggcgaacccttgcggacag
attggcgagacggtggatctggacgaagccgtacagcgcgcgctggcctttgcaaagaaa
gagggtaacacgctggtgatcgtcaccgccgatcacgcccacgccagccagatcgttgcg
ccggagacaaaagcgccgggtctgacccaggcgttgaacacgaaagatggcgccgtgatg
gtgattagctacggcaactctgaagaagagtctcaggagcatacgggcagccagttgcgc
atcgcggcctacggtcctcatgcagccaacgtggtcgggctgaccgatcaaaccgacctg
ttctataccatgaaagcggcgttaggcctgaaataa

DBGET integrated database retrieval system