KEGG   Citrobacter amalonaticus Y19: F384_09425Help
Entry
F384_09425        CDS       T03934                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00500  Starch and sucrose metabolism
cama01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F384_09425
Enzymes [BR:cama01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     F384_09425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AGE94147
UniProt: M1JFT3
LinkDB All DBs
Position
2078879..2080369
Genome map
AA seq 496 aa AA seqDB search
MKNPTLLQFFHWYYPDGGKLWQEVTERADSLNDIGVNMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGTLATKYGDKAQLLAAVDALKKNDIAVLLDVVVNHKMGADEKEAIRVQRV
NEEDRTQIADEIIECEGWTRYTFPARGGQYSQFIWDFKCFSGIDHIENPHEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIEQVEGKTMLFDAPLQLNFHEAS
RQGRDYDMSQIFSGTLVEVDPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDTGGDGETYTIDMPVIEQLDELILARQRFAHGIQTLWFDHPNCI
AFSRSGTDDDPGCVVVLSNGDDGEKTLALGANYGNKTWRDFLGNRSESVVTDENGDATFY
CNAGSVSVWVIEEVIA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccttactgcagttcttccactggtattaccccgacggcggcaaactc
tggcaggaagtgacagagcgtgcagatagcctcaacgatatcggtgtcaatatggtctgg
ctgccacccgcttataaaggcgcgtcaggcgggtattccgtcggctatgactcttacgat
ctgtttgatctcggcgagttcgatcaaaaaggcacccttgcgaccaaatatggtgataag
gcccaactgctggcggctgtcgacgcgctgaagaaaaacgacatcgcggtgctgctcgac
gtggtggtgaatcacaaaatgggggcggacgagaaagaggccatccgcgtacagcgggtc
aacgaagaggatcgcacgcagattgctgatgagatcatcgaatgcgaaggctggacgcgt
tacaccttcccggcgcgcggcggccagtactctcagttcatctgggattttaaatgcttt
agcggcatcgaccacatcgaaaaccctcacgaagacggtatctttaagatagtcaacgac
tacaccggcgagggctggaacgaccaggtcgatgacgagctgggcaatttcgattacctg
atgggcgaaaatatcgactttcgtaatcacgccgtcaccgaggagattaaatactgggcg
cgctgggtgatggaacaaacccagtgtgacggctttcgcctcgatgcggtcaagcacatt
ccggcctggttctataaagagtggattgagcatgttcaggaggtggcgccaaagccgctg
tttatcgtcgccgaatactggtcgcacgaagtggataagctgcaaacctatatcgaacag
gtggaaggcaaaacgatgctgttcgacgccccgttacagcttaattttcatgaggcgtcg
cgccagggccgtgattacgacatgagccagatcttcagcggtacgctggtggaagtcgat
ccgtttcacgccgtcacgctggtcgccaatcacgacacccaaccgttacaggcgctggag
gcgccggttgaagcgtggtttaaacccctggcctatgcgctcatcctgctgcgggaaaat
ggcgtaccgtcggttttctatcccgatctctatggcgcacattatgaggataccgggggc
gacggggaaacctatacgatcgacatgccagtcattgagcaactcgacgaacttattctt
gcccgccagcgtttcgcccacggtattcagacgctctggtttgatcatcccaactgcatt
gcgtttagccgcagcgggacggacgacgatcccggttgcgtggtggtgttatccaatggc
gacgacggcgaaaagacgcttgcgctgggcgcaaactacggcaataaaacctggcgagat
tttctcggcaaccggagcgaaagcgtggtcaccgatgaaaacggcgacgccacgttttac
tgcaacgccggcagcgtcagcgtatgggttattgaagaggtgatcgcgtga

DBGET integrated database retrieval system