KEGG   Citrobacter amalonaticus Y19: F384_09770
Entry
F384_09770        CDS       T03934                                 

Definition
(GenBank) hypothetical protein
Organism
cama  Citrobacter amalonaticus Y19
SSDB
Motif
Pfam: DUF2859
Other DBs
NCBI-ProteinID: AKE58919
UniProt: A0A0F6TV74
LinkDB
Position
complement(2146126..2146614)
AA seq 162 aa
MLKIAIPALLLAFSCATQALIVVADLGGESTAPLFEVIAPEPEREQTPSQVIPLESAVFP
VVTTLLRPGVVSSRPLSLPGMTPLFILGDDPLSVRWLTEHKSRLKSLNATGLVVNVASEA
DLNALRQQAEGLPLLPVSGDDLAQRLQLDTYPVLITDTGLSQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgctgaaaatagctattcctgctttactgcttgcattctcctgtgccactcaggcgctg
atcgtagtggccgacctgggcggcgagtcaaccgctccattatttgaggtcattgcaccg
gaaccggagagagaacagacaccttcgcaggttattccgctggaaagcgccgtattccct
gtggtgaccactcttctgcgtcccggagtcgtatcatcccgcccgctgtcgctgccagga
atgacgccgttgtttattctgggcgacgatccgttgtcggtacgctggctgacagagcat
aagtcccggcttaaatcgctgaatgccaccgggctggtggtgaacgtggcgtcagaagcg
gatctgaatgcactgcgccagcaggcagagggactgccgctgttgccggtcagcggcgac
gatctggcgcagcgcctgcaactggatacatacccggtgctgatcacagataccgggctg
tctcaatga

DBGET integrated database retrieval system