KEGG   Citrobacter amalonaticus Y19: F384_12315Help
Entry
F384_12315        CDS       T03934                                 

Definition
(GenBank) hypothetical protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
cama  Citrobacter amalonaticus Y19
Brite
KEGG Orthology (KO) [BR:cama00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F384_12315
Enzymes [BR:cama01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     F384_12315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: AKE59321
UniProt: A0A0F6TVL8
LinkDB All DBs
Position
2672650..2673297
Genome map
AA seq 215 aa AA seqDB search
MIDLYYAPTPNGHKITIFLEEAALDYRLIKVDISKGNQFRPDFLAISPNNKIPAIVDHAP
VDGGAPLSLFESGAILVYLAEKSGLLLSGELRERCTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGEHYSIADIACWPWVNAWQRQRVDL
EMFPAVKNWFDRIRSRPATERAMLQAHQDTASAKG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctctattacgccccgacacccaatgggcacaagattacgatcttccttgaa
gaggctgcgctggactaccgactcattaaggtggatatcagcaagggtaatcagtttcgc
cctgattttctggccatttcccccaacaataaaatccccgccatcgtcgatcatgctccg
gtcgatggcggcgcaccgctcagcctgtttgaatctggcgccattctggtctatctggcg
gaaaagagtggcctgttgctgagcggcgaattgcgcgagcgctgtaccacgctgcaatgg
ctattctggcaagtgggcggactgggaccgatgctcggtcagaatcaccatttcaaccat
ttcgccccgcaggccatcccctacgctatcgagcgctatcaggtggaaacacagcgactg
tacaacgtcctcaataaacggctggaaacgtcgccgtggctggggggtgaacattacagc
attgccgatattgcctgctggccgtgggtgaacgcctggcagcgccaacgtgtcgacctt
gagatgtttcccgccgtgaagaactggtttgaccgcattcgcagtcggcccgccacggag
cgcgcgatgctgcaggcgcaccaggatactgcgagtgcaaaaggataa

DBGET integrated database retrieval system