KEGG   Citrobacter amalonaticus Y19: F384_12735Help
Entry
F384_12735        CDS       T03934                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00473  D-Alanine metabolism
cama01100  Metabolic pathways
cama01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    F384_12735
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    F384_12735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cama01011]
    F384_12735
Enzymes [BR:cama01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     F384_12735
Peptidoglycan biosynthesis and degradation proteins [BR:cama01011]
 Precursor biosynthesis
  Racemase
   F384_12735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Orn_Arg_deC_N Spherulin4
Motif
Other DBs
NCBI-ProteinID: AHZ96911
UniProt: A0A059VE06
LinkDB All DBs
Position
complement(2751194..2752423)
Genome map
AA seq 409 aa AA seqDB search
MQFRLHHLVLIPLLTLAACNQSATTAPSSSLPVAARHQTAVVNNARLEISASALEYNTQK
IQKLLGNKSSLCAILKGDAYGHDLSLVTPIMLKNNVQCIGVASNQELQTVRELGFKGRLM
RVRNATEQEMRQATEYDVEELIGNLDMAKRLDNIAAQQGKTLRFHLALNSGGMSRNGLEV
SNAAGVNEVKAISELPHLKIVGIMSHYPEEDANAVRKDLARFKVQSQQVLDITGIKRSDV
TLHVANTFATLTVPESWLDMVRVGGVFYGDTIASTDYLRVMTFKSSIAALNHYPKGNTVG
YDRTYTLKRDSVLANIPVGYADGYRRVFSNAGHVLIAGQRVPVVGKTSMNTVMVDVTDLK
NVTPGDEVVFFGKQGSAEITATEVEDISGALFTEMSILWGATNKRVLVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttcgtttacaccatttagtcctcatcccacttttaactctcgctgcctgtaat
cagtcagccaccacagcgccttcaagctcactccccgtcgcggccaggcaccaaacggca
gtagtgaataatgccagacttgagatttcggccagtgcactggaatacaacacgcaaaaa
attcaaaaacttctgggcaataaatcctccctttgcgccattttgaaaggagatgcctat
gggcacgatctctccctcgtcacaccgatcatgttgaaaaacaatgttcagtgtattggt
gttgccagtaatcaggagttgcaaaccgtacgcgaactgggtttcaaaggtcgcctgatg
cgcgtaagaaacgccacggagcaagagatgcggcaggcgacggaatatgatgttgaagag
ctgatcggcaatctggatatggccaaacgtctggacaacatcgccgctcaacaagggaaa
acgttgcgtttccatttagcgctcaactcgggtggcatgtcacgtaacggcctggaggtc
agtaatgctgccggggtgaacgaggtgaaggctatctctgaattaccccatctgaaaatc
gttggcatcatgtcgcactaccctgaagaagatgcgaacgcagtgcgcaaggatttggct
cgtttcaaggtgcagtcccagcaggttcttgatatcactgggatcaaacgcagtgacgtc
acactacacgtcgccaatactttcgcgaccctgaccgtgccagaatcctggctcgatatg
gtacgagtcggcggtgtattttatggcgataccatcgccagcacggactacttgcgcgtc
atgacattcaagtcatccattgcagcgctcaaccattatccgaaaggaaataccgtaggt
tacgatcgcacttatacgctgaaacgtgattcagtgctggcgaatatcccggtaggttat
gccgacggttatcgccgcgtatttagcaatgcaggtcacgtccttattgcggggcagcgc
gtcccggtcgtcggtaaaacctcgatgaataccgtgatggtcgatgtaacggacctgaaa
aacgtcacccctggcgatgaggtggtgttctttggtaagcaaggtagtgccgaaattacc
gccacggaggtcgaggacattagcggtgccctgtttacggaaatgtcgattctctggggc
gcgacgaataagcgcgttttggtggattaa

DBGET integrated database retrieval system