KEGG   Citrobacter amalonaticus Y19: F384_14505Help
Entry
F384_14505        CDS       T03934                                 

Definition
(GenBank) gamma-aminobutyrate transporter
  KO
K11735  GABA permease
Organism
cama  Citrobacter amalonaticus Y19
Brite
KEGG Orthology (KO) [BR:cama00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cama02000]
    F384_14505
Transporters [BR:cama02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   F384_14505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Spore_permease
Motif
Other DBs
NCBI-ProteinID: AKE59682
UniProt: A0A0F6TVZ0
LinkDB All DBs
Position
3159134..3160534
Genome map
AA seq 466 aa AA seqDB search
MGQLSQSHDLGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAQAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWVLVIPLEANIAAIILNSW
VPGVPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIVLGATAIGGFYPH
AEVSGISRLWDHGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPDKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKEVGSYQSVLELLHIPHAKLIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAMMGKINRSKTPYVAVLLSTGAAFLTVVVNYYAPAKVF
KFLIDSSGAIALLVYLVIAVSQLRMRKILLAEGGELKLKMWLYPWLTWLVIGFISFVLIV
MLFRPAQQLEVISTGLLGLGIICTVPIMSRWKKLVLWQKTPLQNTR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaactgtcgcaatcacatgatttagggggcgggctgaaatcacgccacgtcacc
atgctgtctattgccggcgttatcggcgcaagtctgtttgtgggttccagcgtggcgata
gcccaggccgggcccgccgtcctgctagcctatctgttcgccgggttactggtggtgatg
atcatgcggatgctggccgaaatggccgtcgccacgccggacaccggttccttttccacc
tacgccgataaagctatcggccgttgggcgggttacaccatcggctggttgtactggtgg
ttctgggtgctggtgatcccgcttgaagcgaatatcgccgccatcatcctcaactcctgg
gttcccggcgtcccgatctggctgttctcgctggttattacgctggcgttaaccggcagt
aatttgctgagcgtcaaaaactacggtgagtttgagttctggctggcgctgtgcaaagtg
attgccatcctcgcctttatcgtcctcggcgcgacggcgatcggcggcttttaccctcac
gctgaagtcagcggtatctcgcgcttgtgggatcacggcggctttatgccgaacggcttt
ggcgcggtgctgagcgcgatgctgatcaccatgttctcatttatgggcgctgagattgtc
accattgccgccgctgagtccgacacgccggataaacatatcgtccgcgccaccaactcg
gtcatctggcgtatttcaatcttctatctgtgctcgatctttgtcgtcgtcgccctgatc
ccgtggaacatgccgggactgaaagaggttggctcctatcagtcggtattggagctgcta
catattccgcatgccaaactgatcatggactgcgtgatcctgctgtcggtgaccagttgc
ctgaactcggcgctgtatactgcgtcgcggatgctctactccctgagccgccgtggcgac
gcgccagccatgatgggcaaaatcaatcgcagcaaaacgccttacgtggcggtgttgctc
tcaaccggcgcggcatttttaaccgtggtcgtgaactattacgctccggcaaaagtgttt
aagttcctgatcgacagctccggcgccatcgccctgctggtgtatctggtcatcgccgtt
tcccagttgcggatgcgcaaaatcctgctggcggaaggcggcgagctcaaactgaaaatg
tggctctatccgtggctgacctggctggtgattggctttatcagttttgtgctgattgtg
atgctctttcgcccggcgcaacagctggaagttatttctaccgggctgctgggactggga
attatttgtaccgtaccgattatgtcgcgctggaaaaaactggtattgtggcaaaagaca
ccgctgcaaaatacccgttaa

DBGET integrated database retrieval system