KEGG   Citrobacter amalonaticus Y19: F384_17890Help
Entry
F384_17890        CDS       T03934                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00061  Fatty acid biosynthesis
cama00620  Pyruvate metabolism
cama00640  Propanoate metabolism
cama01100  Metabolic pathways
cama01110  Biosynthesis of secondary metabolites
cama01120  Microbial metabolism in diverse environments
cama01130  Biosynthesis of antibiotics
cama01200  Carbon metabolism
cama01212  Fatty acid metabolism
Module
cama_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F384_17890
   00640 Propanoate metabolism
    F384_17890
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    F384_17890
Enzymes [BR:cama01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     F384_17890
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     F384_17890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 ATP-grasp Dala_Dala_lig_C GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AKE60294
UniProt: A0A0F6TXF1
LinkDB All DBs
Position
3897229..3898578
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAQSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLTDDMDANRAHAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQ
SISMTKAEAKAAFSNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVVVKGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGETRDVAIARMKNALQELIIDGIKTNIDL
QTRIMNDEHFQHGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaaattgttatcgccaaccgcggcgagattgcattgcgaattcttcgtgcc
tgtaaagaactgggtatcaagactgtcgctgtgcactcaagcgcggatcgcgatttaaaa
cacgtattactggcggatgagacggtttgtattggcccggctcagtccgtaaaaagttat
ctgaatatcccggctatcatcagcgccgctgaaatcaccggcgcggtggcaattcacccg
ggttatggcttcctctctgagaacgccaattttgctgaacaggttgaacgctctggcttt
atcttcatcggcccgaaagctgacaccatccgtctgatgggcgacaaagtgtcggctatc
accgcgatgaagaaagctggcgtaccaaccgtaccaggttctgacggccctctgaccgac
gatatggatgctaaccgtgcccatgcgaaacgcatcggctacccggttatcatcaaggcg
tccggcggcggcggcggtcgcggtatgcgcgtagtacgcggtgatgccgaactggcgcag
tccatctccatgaccaaagcggaagcaaaagcagctttcagcaacgacatggtttacatg
gagaaatacctcgagaacccacgccacatcgaaattcaggtgttggcagacggtcagggt
aacgctatctatctggctgaacgtgactgctctatgcagcgtcgtcaccagaaagtcgtc
gaagaagcgccggctccgggcattaccccggaactgcgtcgctacatcggtgagcgttgc
gcgaaagcgtgtgtggatatcggctatcgtggcgcaggcacctttgagttcctgttcgaa
aacggcgagttctatttcattgaaatgaacacccgtattcaggttgaacacccggtaact
gaaatgatcaccggcgttgatctgatcaaagaacagctgcgcatcgcggcgggtcaaccg
ctgtcgatcaagcaagaagaagtggtggtcaaaggccatgcggtggaatgccgtatcaac
gccgaagatccgaacaccttcctgccgagtccgggtaaaatcacccgcttccatgcgccg
ggtggctttggcgtacgttgggaatcgcatatctatgccggttacaccgtaccgccatac
tatgactcaatgatcggcaagcttatctgctacggcgaaacccgtgacgtggcaattgcc
cgcatgaagaacgccctgcaggaactgatcatcgatggcatcaaaaccaacattgatttg
cagacccgtattatgaacgacgagcatttccagcatggtggtaccaacatccactatctg
gagaagaaactcggtcttcaggaaaaataa

DBGET integrated database retrieval system