KEGG   Citrobacter amalonaticus Y19: F384_18605Help
Entry
F384_18605        CDS       T03934                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00564  Glycerophospholipid metabolism
cama01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    F384_18605 (glpD)
Enzymes [BR:cama01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     F384_18605 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AKE60427
UniProt: A0A0F6TXM8
LinkDB All DBs
Position
4027127..4028635
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
AGLRFGTESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWVVEAEDIDTGKKFTWQARGLVNATGPWVKEFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKPLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSSYYQGIGPAWTKDCVLPGGEIGGDREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATMVADLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKEGMWLNAE
QQSRMTQWLAEYVEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggaggaggcatcaacggtgccggtatcgcggca
gatgccgctggacgcggtttatccgtgctgatgctggaagcgcaggatcttgcatgcgcg
acctcctctgccagttctaaactcatccacggtggcctgcgctacctggaacactacgaa
ttccggctggtgagcgaagcgctggctgagcgcgaagtgctgctgaaaatggcgccgcac
atcgccttcccgatgcgctttcgtctgccgcatcgcccgcacctgcgtccggcatggatg
atccgcattggtctgtttatgtacgatcacctgggcaaacgcaccagcttaccgggttct
gccggtttgcgttttggcacagagtccgtactgaaacccgaaatcgtgcgcggtttcgaa
tattctgactgctgggtagacgatgcgcgtctggtgctggccaatgcccagatggtggtg
cgtaaaggtggggaggtgttaacccgcactcgtgcaacctctgcgcgtcgcgaaaatggt
ctgtgggtggtcgaagccgaagatatcgataccggaaagaaattcacctggcaggcacgg
ggactggtcaatgccaccggtccgtgggtgaaagaatttttcgacgaaggcatgcatctg
ccttcaccgtatggtattcgcctgatcaaaggcagccacattgtggtgccgcgcgtccac
acccagaaacaggcttatatcctgcaaaacgaagataagcgcattgtgtttgtcattccg
tggatggatgaattctcgatcatcggtaccaccgacgtcgagtacaaaggcgacccgaaa
gcggtgaaaattgacgaaagtgaaatcaattacctgctgaaagtgtacaacgcgcacttt
aagaaaccgctcggtcgcgacgatatcgtctggacctactccggcgtgcgtccgctgtgc
gacgacgaatcggattcaccgcaggccatcacccgtgactacacgctggatattcatgat
gaaaacggcaaagcgccgctgctttccgtcttcggcggtaagttgaccacctaccgtaag
ctcgccgagcacgcgatggagaaattgtcgtcgtactatcagggcattggcccggcatgg
accaaagactgcgtgctgccaggcggtgaaatcggtggcgatcgtgaagactacgcggca
aaactgcggcgtcgttatccgttcctgacggaatcgctggcacgccactactcgcgcacc
tatggcagcaacaccgagtggatccttggtgaagcgacgatggttgctgacctgggtgaa
gacttcggccatgaattctacgaagcagagttgaaatatctggtggaccacgaatgggtt
cgccgcgcggacgatgcgctgtggcgtcgtacgaaagaaggcatgtggctcaacgccgaa
cagcagtcccgcatgactcaatggctggcggagtacgtcgagaaacatcagctttcactg
gcgtcttaa

DBGET integrated database retrieval system