KEGG   Citrobacter amalonaticus Y19: F384_18770Help
Entry
F384_18770        CDS       T03934                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00250  Alanine, aspartate and glutamate metabolism
cama00410  beta-Alanine metabolism
cama00640  Propanoate metabolism
cama00650  Butanoate metabolism
cama01100  Metabolic pathways
cama01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    F384_18770
   00650 Butanoate metabolism
    F384_18770
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F384_18770
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F384_18770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cama01007]
    F384_18770
Enzymes [BR:cama01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     F384_18770
Amino acid related enzymes [BR:cama01007]
 Aminotransferase (transaminase)
  Class III
   F384_18770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKE61994
UniProt: A0A0F6U0G0
LinkDB All DBs
Position
complement(4067335..4068600)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNERRLQATPRGIGVMCGFYAERAENATLWDVEGREVIDFAAGIAVLNTGHRHPK
VIAAIEKQLQSFTHTAYQIVPYESYVRLAERINKRVPIQGPVKTAFFSTGAEAVENAVKI
ARAYTKRPGLITFGGAFHGRTFMTMALTGKVSPYKIGFGPFPGSVYHAQYPNALHGVSTA
DALQSLDRIFKADIAPDQVAAIILEPVQGEGGFNIAPTDFMQALRALCDTHGILLIADEV
QTGFARTGKLFAMEHHGVQADLMTMAKSLAGGMPLSAVAGRAEVMDAPAAGGLGGTYAGN
PLAVAAAHAVLDVIDEEQLCARATALGSTLVEALNEAKADCPFIADIRAQGSMVAVEFND
PHTGKPAPEFTRQVQDRALQQGLLLLSCGVYGNVIRFLYPLTIPEAQFRQALGIITHSLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataacgaactgaatgaacggcgtttgcaggcgacgccgcgcgggatcggcgtg
atgtgcggcttttacgccgagagagcggaaaacgcaacgttgtgggatgtggaaggccgt
gaggtgatcgactttgccgccggtattgcggtgctgaataccgggcaccggcaccccaaa
gtcatcgccgcgattgaaaaacagctccagtcctttacccataccgcgtaccagattgtt
ccctacgaaagctatgtccggcttgcggaacgtatcaacaaacgcgtccccattcagggg
ccggtgaaaacggcgtttttctccaccggtgcagaagcggtcgaaaacgcggtgaagatt
gcccgcgcgtataccaaacgacccggactcattacctttggcggcgcatttcacgggcgg
actttcatgacgatggcgctgaccggcaaggtttcgccttacaaaatcggttttgggccg
tttccgggttcggtttatcacgctcagtatcctaatgcgctacacggcgtgagcaccgcc
gatgcgctgcaaagtctggatcgcattttcaaagcggatatcgcgccggatcaggtcgcc
gccattatccttgaaccggttcagggcgaaggggggttcaatattgcgccaacggatttc
atgcaggcgctacgggcgttgtgcgatacccacggtatcttgttgatcgccgatgaggta
cagaccggctttgcccgtaccggtaagctgtttgcgatggagcatcatggcgtacaggcc
gatctgatgacgatggctaaaagcctggcgggcgggatgccgctctctgcggtggcgggc
cgtgctgaagtgatggatgcgcctgcggcaggcggcctgggagggacgtatgccgggaat
ccgctggccgttgcggcggcacacgcggtgctggatgtgattgatgaagaacaactctgt
gcccgcgctaccgcattgggctcgacgctggtcgaggcgttgaacgaggcgaaagcggac
tgtccgtttattgccgacattcgggctcaggggtcgatggtggcggtggaatttaacgat
ccgcacaccgggaagcccgctccggaatttacccgccaggtgcaggatcgcgccttgcag
caggggcttctgctgctgagttgcggcgtgtatggcaacgtcattcgttttctctatccg
ctcaccattcctgaggcgcaatttcgtcaggcgctcggcattatcacccactcgctgaca
cgataa

DBGET integrated database retrieval system