KEGG   Citrobacter amalonaticus Y19: F384_22665Help
Entry
F384_22665        CDS       T03934                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    F384_22665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cama02000]
    F384_22665
Enzymes [BR:cama01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     F384_22665
Transporters [BR:cama02000]
 Other Transporters
  Pores ion channels [TC:1]
   F384_22665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AKE61163
UniProt: A0A0F6RHR7
LinkDB All DBs
Position
4889403..4890071
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRILWALEELSLPYEIVRYQREKNMLAPPALKKIHPLGKSPVVEDNGA
IIAESGAILDYLQDTYDREGRFKPDDPESTRQYRFWLHYAEGSLMPLLLMKLVFVSLGKP
PMPFGLRTLGGALGQGVQKAYLNPQLETHARFIDAHLAGRPWFAGEHLSMADIQMSFPLF
ALLARGGIAELPHIRAWKERVEMRPAWQRAIQQGGPFDIPGG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtgcatcatttaaaccagtcccgctcacagcgcattctctgggcgctggag
gagttgtcgctgccttacgagattgttcgttatcagcgagagaagaacatgctcgccccg
cctgccctgaagaaaatccatccgctgggtaaatctccggtagtggaagataacggtgca
atcattgcggaatcgggggccattctcgactatttgcaggacacttatgaccgcgaaggg
cggtttaaaccggatgacccggagtcaacgcgccagtaccgcttctggctgcactatgcc
gagggatcactgatgccgttgctgttaatgaagctggtcttcgtcagcctgggtaaaccg
ccgatgccctttggtttgcgcacgctgggcggcgcgctggggcagggcgtacaaaaagcg
tatctcaacccacaactggaaacccacgcgcgctttattgacgcgcatctcgccgggcgg
ccatggtttgccggggagcatctcagcatggcggatatccagatgagttttcccctgttt
gcactgctggcgcgcggcggtattgccgagctcccccacatccgcgcgtggaaagaacgc
gtagagatgcgtcccgcctggcaacgtgccattcagcagggtggaccttttgacattccc
ggcggctga

DBGET integrated database retrieval system