KEGG   Corynebacterium ammoniagenes: CAMM_02385Help
Entry
CAMM_02385        CDS       T05164                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
camg  Corynebacterium ammoniagenes
Brite
KEGG Orthology (KO) [BR:camg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:camg03012]
    CAMM_02385
   03029 Mitochondrial biogenesis [BR:camg03029]
    CAMM_02385
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:camg04147]
    CAMM_02385
Translation factors [BR:camg03012]
 Eukaryotic Type
  Elongation factors
   CAMM_02385
 Prokaryotic Type
   CAMM_02385
Mitochondrial biogenesis [BR:camg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CAMM_02385
Exosome [BR:camg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CAMM_02385
  Exosomal proteins of breast cancer cells
   CAMM_02385
  Exosomal proteins of colorectal cancer cells
   CAMM_02385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: APT81813
UniProt: D5NYN9
LinkDB All DBs
Position
484857..486047
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERSKPHVNIGTIGHVDHGKTTTTAAITKVLADQYPEENEAFAYDMIDKAPEEKE
RGITINISHVEYSTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQEFDEEAPIVHISALGAL
NGEEKWVQSVVDLMQACDDSIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGQLNV
NEDIEIIGIQEKSLSTTVTGIEMFRKMMDYTEAGDNCGLLLRGTKREEVERGQVAIKPGA
YTPHRKFEGSVYVLKKEEGGRHTPFMDNYRPQFYFRTTDVTGVVKLPEGVEMVMPGDNVD
MSVELIQPVAMDEGLRFAIREGSRTVGAGRVTKVIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagtttgagcgttcgaagccgcacgtaaacatcggcaccatcggacac
gtcgaccacggtaagaccaccacgaccgcagctatcaccaaggtactggcagaccagtac
cctgaggagaacgaagcgttcgcttacgacatgatcgataaggctcctgaggagaaggag
cgtggtattaccattaacatctcccacgttgagtactccacccctaagcgccactacgca
cacgtagacgctccaggccacgcggactacatcaagaacatgattaccggtgctgctcag
atggacggcgctatcttggttgttgctgcaaccgatggcccaatgccacagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgcactgaacaagtgt
gacatggttgacgatgaggaaatcatcgagctcgttgagatggaagttcgtgaacttctg
gctgagcaggagttcgacgaggaagctccaatcgttcacatctccgctctgggcgccctg
aacggcgaagagaagtgggtacagtccgtcgttgacctgatgcaggcttgcgatgactcc
atcccagacccagttcgtgaaactgacaagccattcttgatgcctatcgaggacatcttc
accattaccggtcgtggcaccgttgtcaccggtcgtgttgagcgcggtcagctgaacgtt
aacgaagacatcgagatcatcggtatccaggagaagtccctctccaccaccgttaccggt
atcgagatgttccgtaagatgatggactacaccgaggctggcgacaactgtggtctgctt
ctgcgtggtaccaagcgtgaagaggttgagcgcggccaggttgctattaagccaggcgct
tacacccctcaccgcaagttcgagggctccgtctacgtcctgaagaaggaagagggcggc
cgccacaccccattcatggacaactaccgtccacagttctacttccgcaccaccgacgtt
accggtgttgtgaagttgcctgagggtgtcgagatggtcatgcctggcgataacgtcgac
atgtccgttgagctcatccagccagttgctatggacgagggcctgcgcttcgctatccgc
gaaggctcccgcaccgttggcgctggtcgcgtgaccaaggttatcgagtaa

DBGET integrated database retrieval system