KEGG   Corynebacterium ammoniagenes: CAMM_07590Help
Entry
CAMM_07590        CDS       T05164                                 

Definition
(GenBank) NTP pyrophosphohydrolase
  KO
K23258  8-oxo-dGTP phosphatase [EC:3.6.1.-]
Organism
camg  Corynebacterium ammoniagenes
Brite
KEGG Orthology (KO) [BR:camg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:camg03400]
    CAMM_07590
Enzymes [BR:camg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     CAMM_07590
DNA repair and recombination proteins [BR:camg03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    CAMM_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX His_Phos_1
Motif
Other DBs
NCBI-ProteinID: APT82789
UniProt: D5NZW8
LinkDB All DBs
Position
1643222..1644196
Genome map
AA seq 324 aa AA seqDB search
MHETDKDIQSESFISGRLQHVPKDPKAEFKRTTLAAGAVLWRGDPQAPEVALIHRPHYDD
WSLPKGKVDPGESLPATVARELWEETGYQVKLGKLVGKVTYPVQGRTKVVYYWLAQVLSG
EFIANEEADELVWMPIADARERVTYKLDEDVLDKALKRLQLMPETLVLYVRHARAHDRKT
WSGDDNLRPLDKKGRRQAEMLVSELAPYHPTAIYSAVPDRCLQTAAPLADELNLSIHVDA
LLGDDAWVDQPTKARLAFESIVARGGTPVIVSQGLTIPSIIDSYAPKFMDTDDLKVKKSS
VWVLSFLHGELTGADYLASPLPVR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaactgataaagacatccaatcggaatctttcatatctggccgcttacagcat
gttcccaaagaccccaaggcagaattcaagcgcaccaccctggcagcaggtgccgtgtta
tggcgcggcgacccgcaagcacctgaggtggcgttaattcaccgcccccactacgacgat
tggtccttgcccaaaggaaaagttgaccccggggagtccttgcccgccaccgtggcgcgt
gagttgtgggaagaaaccggctaccaggtcaagctgggcaaactcgtcggcaaagtcacc
tacccggtgcaagggcgcaccaaggtggtttactactggctggcgcaggtgttatccggt
gaatttatcgccaatgaagaagccgatgaactggtgtggatgcccattgccgatgcccgc
gagcgcgtgacgtacaagctcgatgaagacgtgttggataaggccttaaagcgcttgcag
ttaatgccagagaccttggtgttatatgtccgccacgcccgcgcgcatgatcgtaagaca
tggagcggggatgataatttgcgcccattggataaaaagggtcgtcgacaagcggaaatg
cttgtctctgagcttgctccctaccaccccactgcgatctattccgccgtgcccgatcgg
tgtttgcaaaccgctgcgccgttggcagatgagctcaatctttccatccacgttgacgcg
ttgcttggcgatgatgcctgggtagaccaacccaccaaagcccgcctggcatttgagtcc
attgtcgcccgcggtggcacccccgtgattgtctcgcagggactgactatcccgtccatc
attgactcttatgccccgaagtttatggataccgatgacttgaaggtcaaaaagtcctct
gtgtgggtcttaagctttctacatggcgagctgaccggcgcggactatttagcctccccg
ctgccggtgcgatag

DBGET integrated database retrieval system