KEGG   Corynebacterium ammoniagenes: CAMM_12685Help
Entry
CAMM_12685        CDS       T05164                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
camg  Corynebacterium ammoniagenes
Pathway
camg00010  Glycolysis / Gluconeogenesis
camg00071  Fatty acid degradation
camg00350  Tyrosine metabolism
camg00625  Chloroalkane and chloroalkene degradation
camg00626  Naphthalene degradation
camg01100  Metabolic pathways
camg01110  Biosynthesis of secondary metabolites
camg01120  Microbial metabolism in diverse environments
camg01130  Biosynthesis of antibiotics
camg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:camg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAMM_12685
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CAMM_12685
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CAMM_12685
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CAMM_12685
   00626 Naphthalene degradation
    CAMM_12685
Enzymes [BR:camg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CAMM_12685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: APT83709
UniProt: D5NWW9
LinkDB All DBs
Position
2756770..2757807
Genome map
AA seq 345 aa AA seqDB search
MSAAESQTFNAAVVEKFGQEVTVKEIDLPQPGPNQALVKVLTSGICHTDLHALEGDWPVK
PAPPFVPGHEGVGEVVELGPGEHDVKVGDIVGNAWLWSACGTCEFCITGRETHCPDAEYG
GYTQNGSFGEYMLVDTRYAARIPEGVDYLEAAPILCAGVTVYKALKQSEARPGQFMVISG
IGGLGHIAVQYAVAMGLRVIAVDIATEKLDLASRLGAEYTVNAGDEDPGSAVQKYTEGGS
HGVLVTAVHEAAFGQALDMARSGGTIVFNGLPPGEFPASVFDIVFRGLTIRGSLVGTRQD
MTEALDFFARGLIKPTVTECSLDDVNDVFERMRNGQIDGRVAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgctgaatcccaaacttttaatgctgctgttgtagaaaaatttggccaggaa
gtcaccgtcaaagagattgaccttccacaacctggccccaatcaagcactggttaaagtg
cttacctctggaatttgccatacggatctccacgcgcttgagggcgactggccggtaaaa
cctgcaccaccgtttgtacctggacatgaaggtgtcggggaagtagtggaacttggccct
ggggagcatgacgtcaaggttggagacatcgtcggcaacgcttggttatggtccgcttgt
ggcacttgtgaattctgcatcacaggtcgagagacccattgtcccgatgccgaatatgga
ggctatacccagaacggctcctttggcgagtacatgctggtcgacacgcgctatgctgcc
cgcatcccggagggagtggactacctagaagcagctcccatcctatgcgctggggtgacc
gtctataaagccctcaagcagtccgaggcacgcccaggtcaatttatggtcatttccggg
atcggcggcttggggcatattgctgtgcaatacgccgtagcgatgggtctacgtgttatc
gcagtagatattgcaaccgaaaagctagacctagcatctagactcggcgctgaatatacc
gtcaacgcaggcgacgaagaccctggctcagctgttcaaaaatacaccgagggcggatcc
catggcgtattggttacagcagtccacgaagcagcatttgggcaagctctggacatggca
cgcagcggcggcacaatcgtcttcaacggactgccacctggagaatttcctgcatctgta
ttcgacatcgtgttccgaggattaactatccgcggatctctggtaggcactcgacaagat
atgacggaggcgttggacttctttgctcgcggtttaatcaaacctaccgttactgaatgc
tcacttgatgatgtcaacgatgtctttgagcgaatgcgtaacggccagatcgacggtcgg
gtggcgatccggtactaa

DBGET integrated database retrieval system