KEGG   Campylobacter fetus subsp. testudinum 03-427: CFT03427_0321Help
Entry
CFT03427_0321     CDS       T02899                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acp] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
camp  Campylobacter fetus subsp. testudinum 03-427
Pathway
camp00061  Fatty acid biosynthesis
camp00780  Biotin metabolism
camp01100  Metabolic pathways
camp01212  Fatty acid metabolism
Module
camp_M00083  Fatty acid biosynthesis, elongation
camp_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:camp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CFT03427_0321 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CFT03427_0321 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:camp01004]
    CFT03427_0321 (fabZ)
Enzymes [BR:camp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CFT03427_0321 (fabZ)
Lipid biosynthesis proteins [BR:camp01004]
 Fatty acid synthase
  Component type
   CFT03427_0321 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT 4HBT_2 MaoC_dehydratas AveC_like
Motif
Other DBs
NCBI-ProteinID: AGZ81209
LinkDB All DBs
Position
291113..291559
Genome map
AA seq 148 aa AA seqDB search
MIDVVEIQKILPHRYPFLLIDRVCELETGKSVYAYKNITIAEQIFEGHFPGHPIYPGVMI
IEGMAQAGGILAFKSIEDPNGLSIENKVVYFMSIDRAKFRNPVKPGDKLEYRLEVLKHKG
NIWVLDGKAYVDDKLVAEAELKAMIVDK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgatagacgtagtagaaattcaaaaaattttaccacataggtatccgtttttgttaata
gacagagtttgtgaattagaaacgggtaaaagtgtttatgcgtataaaaatataactatc
gcagaacaaatttttgaaggacattttccaggacatccgatatatcctggtgttatgata
atagaaggaatggcgcaagcaggcggtatcttagcatttaaaagcatagaagatccaaat
ggcttgagcatagaaaataaagttgtatattttatgagtatcgatagggctaaatttaga
aatccagtaaaaccaggagataagttagagtatcgtttagaggtattaaaacacaaagga
aatatttgggttttagacgggaaagcttacgtagatgataaattagtagctgaggctgag
ctaaaagctatgatagttgataagtag

DBGET integrated database retrieval system