KEGG   Campylobacter sp. RM16704: CAQ16704_0670Help
Entry
CAQ16704_0670     CDS       T03560                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
camr  Campylobacter sp. RM16704
Pathway
camr00473  D-Alanine metabolism
camr00550  Peptidoglycan biosynthesis
camr01100  Metabolic pathways
camr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:camr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CAQ16704_0670 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAQ16704_0670 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CAQ16704_0670 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:camr01011]
    CAQ16704_0670 (ddlA)
Enzymes [BR:camr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CAQ16704_0670 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:camr01011]
 Precursor biosynthesis
  Amino acid ligase
   CAQ16704_0670 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AJC86141
UniProt: A0A0A8GWH9
LinkDB All DBs
Position
642222..643262
Genome map
AA seq 346 aa AA seqDB search
MIYGVIFGANSYEHEISIVSAVVLKKVLKAQKKFIFCDKNKEFFLINEEKMNAKFFSSGA
YKKEKVLVLKQGGFFYKTVLGEKKLKIDVAINIVHGKDGEDGKIAALLDFYGVKYIGPRL
EASVLSFNKILTKLFAQSVGVKVFDYKTLNLYKKQTKSLKFPCILKPARLGSSIGISIAK
DENELKYAKDVAFEFDEDIIVEEFISNIKEYNLAGCMIDEKIEFSIIEEPKKNQILDFEQ
KYLGFSESSKVKEADIGESLKQKLRENFTKIYDPLFKGSLIRCDFFVVDNEVYLNEINPN
PGSLANYLFDDFTQVINQLAKNVELEKQIKINYAFIHNINGQKGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgatatatggtgtaatttttggtgcaaattcttatgaacatgaaattagtatagtaagt
gcagtggtgttaaaaaaagttcttaaagcacaaaaaaagtttatattttgtgataaaaat
aaggaattttttctcataaatgaagaaaaaatgaatgcaaaattttttagcagcggtgct
tataaaaaagaaaaagttttagtattaaagcagggtggatttttttataaaaccgtacta
ggtgaaaaaaagcttaaaatagatgtggcaataaatatagtacatggaaaagatggagaa
gatggaaaaatagcagcattgcttgatttttatggtgtaaaatatataggaccgcgtttg
gaagctagtgttttatcttttaataaaattttaacaaaactttttgcacaaagcgttggg
gtgaaagtatttgactataaaacattaaatttgtataaaaaacaaacaaaatctctgaaa
tttccttgtattttgaaacctgcaagacttggaagtagtataggtataagcatagcaaaa
gatgaaaatgaacttaaatatgctaaagatgtagcttttgaatttgatgaggatataatt
gtagaggaatttataagtaatattaaagagtataatttagctggttgtatgatagatgaa
aaaattgaattttctatcattgaagaacctaaaaaaaatcaaattttagattttgaacaa
aaatacttaggtttttcggaaagctctaaagtgaaagaagcagatatcggtgagagttta
aaacaaaaacttagagagaattttactaagatctatgatcctttatttaaagggtcgttg
atacgctgtgatttttttgtagtagataatgaggtttatttaaacgaaattaatccaaat
ccgggttctttagcaaattatttatttgatgattttacacaagtaataaaccaattagct
aaaaatgtggagcttgaaaagcaaattaagattaactatgcttttattcataatatcaat
gggcaaaaaggtaaattataa

DBGET integrated database retrieval system