KEGG   Campylobacter sp. RM16704: CAQ16704_0697Help
Entry
CAQ16704_0697     CDS       T03560                                 

Gene name
pbpC
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
camr  Campylobacter sp. RM16704
Pathway
camr00550  Peptidoglycan biosynthesis
camr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:camr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAQ16704_0697 (pbpC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CAQ16704_0697 (pbpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:camr01011]
    CAQ16704_0697 (pbpC)
Enzymes [BR:camr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CAQ16704_0697 (pbpC)
Peptidoglycan biosynthesis and degradation proteins [BR:camr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CAQ16704_0697 (pbpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AJC86168
UniProt: A0A0A8GW76
LinkDB All DBs
Position
668305..670143
Genome map
AA seq 612 aa AA seqDB search
MRMRLVMGFIGCFFILLLARVYYISIKSNAYYDEIAKQNAIKTQFLAPIRGQILDIKGRP
LAVNKLGFTISIKPYLYIKKNNNIFLEQELQAIVQAFPDLNITKLKKTYIKGDSYYNQDY
IEVVPFIEYDMMIKHFTKLNLRENMQVKSTTQRFYPYNDLASHVIGYVGKANLNDMNENE
IARLTSYVGRSGIERSYNDILQGQKGEKISKVDALNKEIEELSYKRPISSNITLNIDLDL
QEYLAALFENLAGAAIIMDVNSGAILAAGSFPEYNLNPFVTGITQEEWNRLSNDLNHPFT
NKLINGLYPPGSVVKMGTALAFLNSGKFNENQKFLCDSNFELGGRKFRCWKTIGHGFMDM
NDAIRESCDVYFYKGALEVGIDIISSVFERIGFGEKTGVDLPNEFIGTVPSKMWKKEKYN
QPWYQGETLNTSIGQGDFLATPMQVAKFTAMIATSKNVTPHFLYNIDDNITKLNFDNNNN
NNKGVFTTFELSKLPLLRRAMYEVANEQGGTTARYLKNLPITIAAKTGTAQVVGISQSEK
KRIKEEDLEYFLRSHAWITSYAPYEKPQYVVVLLIEHGKSGSSTGGPMLAKIYQKLIDLG
YIDKKYIKKKVK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatgcgtttggtaatgggctttataggttgtttttttatacttttgcttgctaga
gtgtattatattagtataaaatcaaatgcatattatgatgaaattgcaaaacaaaacgct
ataaaaacgcaatttttagcaccaataagagggcaaattttagatataaaaggaagacct
ttagctgtaaataaattgggttttactatatctataaaaccttatttatatattaagaaa
aataataatatttttttagaacaagaattacaagctatagtacaagcttttccagattta
aatatcactaaattaaaaaaaacatacattaaaggtgattcttattataaccaagactat
atagaagtggtaccttttattgagtatgatatgatgataaaacattttaccaaacttaat
ttacgtgaaaacatgcaagtgaaatctacaactcaaagattttatccatataatgattta
gctagtcatgttataggttatgttggaaaagcaaatttaaatgatatgaatgaaaatgaa
atagcaagacttactagttatgtaggacgtagtggtattgagcgatcatataatgatatt
ttgcaaggtcaaaaaggtgaaaaaattagtaaagtcgatgccttaaataaagaaatcgaa
gaactttcgtataaaagacctatttctagtaatataacattgaatattgatcttgatttg
caagaatatctagctgctctttttgaaaatttagcaggtgctgctattattatggatgta
aatagtggtgctattttagctgctggaagttttcctgaatataaccttaatccttttgtt
actggtattactcaagaagaatggaatagactttctaatgatttaaatcatccttttact
aataaacttattaatgggctttatcccccaggctctgttgttaaaatgggaacagcatta
gcctttttaaatagcggaaaattcaatgaaaatcaaaaatttttatgtgattcaaatttt
gaactaggtggtagaaaatttagatgttggaaaacaataggacatggttttatggatatg
aatgatgctattagagaaagttgtgatgtgtatttttacaaaggtgctttagaagttgga
attgatatcattagttctgtttttgaaagaattggttttggagaaaaaacaggagtagat
ttgcctaatgaatttatcggaactgttcctagcaaaatgtggaaaaaagaaaaatacaac
caaccttggtatcaaggagaaactttaaatactagcataggacagggtgattttttagct
actcctatgcaagtagctaaatttacagctatgatagcaacatcaaaaaatgttactcca
cattttttgtataacatagatgataatatcacaaaattaaattttgataataataataat
aataataaaggtgtttttactacctttgaactttcaaaattaccacttttgaggcgtgca
atgtatgaagtggctaatgaacaaggcggtacaactgcaagatatttgaaaaatttacct
ataaccatagcagcaaaaacaggaactgctcaagtagtagggatttcgcaaagcgagaaa
aaacgtattaaagaagaagatttagagtattttttaagatcacatgcttggatcacttct
tatgctccttatgaaaagcctcaatatgttgttgtgcttttaatagaacatggaaaaagc
ggtagtagtacaggtggtcctatgcttgctaaaatttatcaaaaacttatagatttagga
tatatagataaaaaatatatcaagaaaaaagttaaataa

DBGET integrated database retrieval system