KEGG   Cyclobacterium amurskyense: CA2015_0164Help
Entry
CA2015_0164       CDS       T03993                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00240  Pyrimidine metabolism
camu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:camu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CA2015_0164
Enzymes [BR:camu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CA2015_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AKP49646
UniProt: A0A0H4P5G2
LinkDB All DBs
Position
212481..212996
Genome map
AA seq 171 aa AA seqDB search
MFSGKTEELIRRLNRALIAKQKVEIFKPAIDKRYDDNNVVSHDENIIRSTPVQFAEDILL
LAGNCDVVGIDEVQFFDAQIIPVVEKLAKTGTRVIIAGLDMDFKGKPFEPMPQLMAMAEY
VTKVHAICMKCGDLASFSYRLSAEKTKVMLGEKESYEARCRRCFFDLDVTT
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgttttctggtaaaacagaagaattgataagaagacttaacagggcgttaatcgccaaa
caaaaggtggaaatatttaaacctgccatcgataaaaggtatgatgacaataatgtagtc
tcacatgatgaaaacattatccgatctacccctgtacaatttgctgaagacattttgctt
ctagcaggtaattgcgatgtggtaggaattgacgaagttcagttttttgatgcccaaata
attcctgttgtagaaaaacttgccaagactggtactcgggtaattattgccggtctagac
atggactttaaagggaagccttttgagccgatgcctcaattaatggcaatggctgaatat
gtcactaaagtacatgctatatgtatgaaatgcggtgatcttgcttcttttagttacaga
ttgtctgcggaaaaaaccaaggtaatgctgggagaaaaagaaagctatgaggcccgttgt
cgcaggtgtttttttgacctagatgtaaccacttaa

DBGET integrated database retrieval system