KEGG   Cyclobacterium amurskyense: CA2015_1090Help
Entry
CA2015_1090       CDS       T03993                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:camu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CA2015_1090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:camu03400]
    CA2015_1090
Enzymes [BR:camu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CA2015_1090
DNA repair and recombination proteins [BR:camu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CA2015_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AKP50542
UniProt: A0A0H4PQK2
LinkDB All DBs
Position
1345734..1348166
Genome map
AA seq 810 aa AA seqDB search
MGLKAYRQKRSFEDTPEPKDVLEKSNQSRFVIQRHRASHLHYDLRLEMDGVLKSWAVPKG
PSMNPRDKRLAVQTEDHPIAYLSFEGVIPKGNYGAGKMTIWDEGNYKNLHPQNSLSSDYN
TGKLKIIFHGSKLKGLFTLVRSSSMNKKEQWLLIKHDDAFATDLDYDAEDFTDEAFSIKP
FQNPKKLDLRTLVKPMLASPGTKIFNDKDWVYELKYDGYRALANINNGKVELYTRNGISL
NEKFTPIHKELKNIAHRAILDGEIVVLDAEGMPQFNALQNYNEETTKGVLVYYVFDLLHL
NDHDTLELPLIDRKQLLKELIPEASHLHYCDHVETMGITIYNQAVEMGMEGVIAKKANSR
YDLNLRSPHWLKFKKIENTETILCGYTLSKKKSRKFASLILGMVEDGQLTYVGTCGSGFS
EEQLKELYYKFEVLKTEEPVFDIRKHLKGREAVWLIPKLICEVKFSEWTSSKVMRHPVFL
RLREDKNLDLEQPQLPSKNPTPQKKTPDEEFALKVDGITLHITHPEKSYWPESGYTKYDL
LDYYIQMSDIILPYLVDRPESLHRHPNGIHGESFYQKDNEHLPDWTDTHTIYSTSSDKDI
NYVLCQNKATLLYLNNLGCIELHPWHSTIYQLDHPDYAIIDLDPSDENTFEQIIETALVA
NDILKLASIEGFCKTSGASGLHIYLPMGGKYTYEEARDFTKLLCYYIQEKLPKLTTLERS
LKKRGPKIYLDYLQNRKGQTIVAPYSLRPQLHATVSMPLLWSEVKTGLKITDYTIKTVPN
IMAERKDSFKAVLGKAIDMGKAIEHLNNLS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaaagcgtaccgacaaaagcgaagttttgaagacacacctgaacctaaagat
gtgcttgaaaaaagcaaccaatccaggtttgtcatccaaagacatcgtgccagtcattta
cattacgacctgcgtttagaaatggatggagttctcaaaagctgggcagtccctaaagga
ccttccatgaatccccgagacaagcgtctggcagtacaaaccgaagaccaccccattgct
tacttaagctttgaaggggtcattccaaaaggcaattatggcgcaggaaaaatgaccatt
tgggatgaggggaactacaaaaatttacacccacaaaattccctgtcttcagactataac
actgggaagctaaaaatcatctttcacggcagcaaactcaagggactttttaccttggtc
cgttcttcctccatgaataaaaaagaacaatggttactcataaaacatgatgatgcattt
gccactgacctggattacgatgccgaagactttaccgatgaggcattttctataaagcca
ttccaaaacccaaaaaaattagaccttaggacccttgtaaaacccatgctcgcctctccg
gggacgaaaatctttaacgataaggactgggtatacgagttaaaatatgatggctaccgg
gcattggctaacatcaataatggaaaggtggagctctatacacgcaatggaatttctctc
aatgaaaaattcactcctatccataaggaactaaaaaacatagcgcatagggcaattcta
gacggtgaaatagttgtgttggacgctgaaggaatgccacaatttaatgcattgcaaaat
tataatgaagagaccaccaaaggagtattggtatattatgtatttgatttgttgcatctc
aacgatcacgacacattggaacttccattgatagaccgcaagcaattgctaaaagaatta
attccagaagcgtcgcatcttcactattgcgaccacgttgaaaccatgggaataacaatc
tataaccaagccgtagaaatgggaatggaaggtgtcatcgccaaaaaagccaattctcgt
tacgacctaaaccttcgctctcctcactggctaaagttcaaaaaaattgaaaacacagaa
acgatcctctgtggctatacgctttccaagaaaaaatcccgtaagtttgcgtccttaatt
ttagggatggtggaagatggccaattgacctatgtgggtacttgtggttccggtttttca
gaagaacagcttaaagagttgtattacaagtttgaagtacttaaaaccgaggagccagtg
ttcgatattcgcaaacacctcaaaggccgtgaagcggtatggttgattcctaaactgatt
tgtgaagtgaagttttcggaatggacttcatctaaggtaatgcgccacccagttttttta
aggttgcgtgaggataaaaatttggacttagaacagcctcaattaccatctaaaaatcca
actcctcaaaaaaagacacctgatgaagaatttgctttaaaagtggatggaatcaccctc
cacatcacacatcctgaaaagagctattggccagaatccggttataccaaatacgatttg
ttagattattatattcagatgtctgacatcatcctaccctacctcgtagaccgtcctgaa
agcttgcatcgacatcccaatggcatccatggcgaatccttttaccagaaagacaatgag
catttgcctgactggacagatacccataccatttattcaacatcttctgacaaagacatc
aattacgtattatgtcaaaacaaggccaccttgctgtatttaaataacctaggatgcatc
gaacttcatccctggcattccaccatttatcaattggatcatcctgattatgctatcatc
gatttagacccctcagacgagaacacattcgaacagataattgaaacggcattggtagcg
aatgacattttaaagttggcaagtattgagggcttttgcaaaacctctggcgcatcagga
ttacatatttatcttcccatgggaggaaaatacacctatgaagaagcacgagatttcacc
aaattactttgctattatatccaggaaaaacttccaaaactgaccactttggaacgctcg
ctcaaaaagagggggccgaaaatatatttggattacctacagaaccgaaaaggccaaacc
atcgttgcgccttacagtttaaggcctcagcttcatgctacagtatcaatgccattgctc
tggtcagaagttaaaaccggattaaaaattaccgactacaccataaaaacagttccaaac
atcatggctgaaaggaaagatagtttcaaagctgtcttaggcaaagccattgatatgggc
aaagccatcgaacacctaaacaatttaagttga

DBGET integrated database retrieval system