KEGG   Cyclobacterium amurskyense: CA2015_2337Help
Entry
CA2015_2337       CDS       T03993                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00564  Glycerophospholipid metabolism
camu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:camu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CA2015_2337
Enzymes [BR:camu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CA2015_2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Lycopene_cycl HI0933_like Pyr_redox_2 Pyr_redox_3 GIDA NAD_binding_8 Pyr_redox Thi4
Motif
Other DBs
NCBI-ProteinID: AKP51754
UniProt: A0A0H4PBX4
LinkDB All DBs
Position
2823342..2824907
Genome map
AA seq 521 aa AA seqDB search
MNRKDSLSIIEDEKGVWDLVIIGGGASGLGVALDALSRGLKVLLLEKSDFAKGTSSRSTK
LVHGGVRYLAQGEVGLVLEALRERGRLLKNAPHLTINQPFVIPLYSFFDRLKYGVGLKIY
DWMAGSLRLGKSKFVSREDTIKRLPQIRQKGLKGGILYHDGQFDDARLALVIAKTCIEMG
GSILNYARVNKLSKDETGKINGVVFRDLIGKKNYKVSTKSVVNATGVFADKILQMDNPEA
RKMIQPSQGIHLVMDNSFLGGDDALMIPETSDGRVLFAVPWEGKLVVGTTDTLVKKPKME
PRPLASEINFILETASNYLVKPPKRSDVLSVFAGLRPLAAPKEGSTKTKEISRSHKVIVS
KSKLITITGGKWTTFRKMGEDTVDAHFKNNNLTAIESTSASKHLHGYSLKEVDGHLKLYG
SDASFILDLQKQNPEWAERIHEDYPYTGAEVVWAVREEMAQKIEDFLSRRCRILLLDAKA
SMQMAPKVAAIMAKELGNDDEWITEELEEFYKLARKYLINI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaaaagacagtttatcaattattgaagacgaaaagggagtctgggacctagtg
ataataggtggtggagcttccggattaggggttgcattggacgctttgtccagaggtttg
aaggttttattgttggagaaatctgattttgctaaaggcacttcgagtaggagtaccaag
cttgttcatggaggggttagataccttgcccagggagaagtaggcttggttttggaagcg
ctgagggagagaggcaggttattgaaaaatgcaccacatttaacaatcaaccaaccattt
gttattccgttgtattctttttttgatcggctgaaatatggtgtagggttaaaaatttac
gattggatggctggtagcttgcgtttggggaaatccaagtttgtttccagagaagacact
ataaaaaggttgccgcaaattcgacaaaaaggtcttaaaggtggtattttataccatgat
ggacagtttgatgatgcgcgacttgccttggtgatcgccaagacctgtattgaaatggga
ggttctatactcaattatgctagggtgaacaagttgagcaaagatgaaactggtaagatt
aatggggtagtttttagggacttgattggtaagaaaaattataaggtttccaccaaatct
gtggttaatgctacgggagtttttgcagataagattttgcaaatggacaatcccgaagcc
cgtaagatgatccaacctagccagggtatccatcttgtgatggacaattcttttttgggt
ggagatgatgctttgatgattcctgagacctccgatgggagagtgctttttgctgttcca
tgggaagggaagttggtggtcggaactaccgatactttggtgaagaaaccaaaaatggag
cctagacctttggcctctgaaattaattttattctggaaaccgccagtaattacttagta
aaaccacccaaaagatccgatgttttgtctgtctttgcaggacttaggccacttgcagct
ccaaaagagggcagtaccaagactaaggaaatatccagaagtcataaggttatagtctct
aagagtaaactgataaccataactggtggcaagtggactactttcagaaaaatgggagaa
gacactgtggatgctcattttaagaacaataatctgactgcaatagaaagtacatctgct
agcaaacatttgcatgggtatagccttaaggaggttgatgggcatttgaaactatatggt
agcgatgcttcatttattcttgacttacagaagcaaaatcctgaatgggctgagcgaatt
catgaggattacccttatacgggagcagaggtagtatgggcagttcgtgaggaaatggcc
caaaagattgaagattttctctcccgacgatgtagaattttattgcttgacgccaaagct
tcgatgcaaatggcacccaaggtggccgcaatcatggcaaaagaacttgggaatgatgat
gaatggataaccgaagagttagaagaattttataaattagccagaaagtatttaattaac
atctaa

DBGET integrated database retrieval system