KEGG   Cyclobacterium amurskyense: CA2015_2804Help
Entry
CA2015_2804       CDS       T03993                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00620  Pyruvate metabolism
camu00680  Methane metabolism
camu01100  Metabolic pathways
camu01120  Microbial metabolism in diverse environments
camu01200  Carbon metabolism
Module
camu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:camu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CA2015_2804
  09102 Energy metabolism
   00680 Methane metabolism
    CA2015_2804
Enzymes [BR:camu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CA2015_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKP52214
UniProt: A0A0H4PD88
LinkDB All DBs
Position
3377810..3380362
Genome map
AA seq 850 aa AA seqDB search
MANIYETEVAKRFTIYNSLFLDLPFDQIYRTGTLLPILSEACQSGFQENKTPKEIIRQFF
EELMADKPEEERHDLLFKMVQYIERQVVLFDSIEDASFEKFNDIKGKGTMTALIARAEND
HKKEELIEKLKNFSVRLTLTAHPTQFYPGNVLAIITDLEQAIRKNDLGDVDLLLRQLGKT
AFINKEKPSPYEEAVSLTWFLEYVFYPSISDIMIRILNQLNIPLHDWENPNLLKVGFWPG
GDRDGNPFVTHEITKKVSDKLQNSILKCYYRDIRKVRRRLTFHNVESHLIKAEKGIYNTL
FSGEGEVFHSKDELLAVLYEARKGIIEEHGGLSLELLDEFILKVRVFGFHFASMDVRQDS
RKHDALWDEILEKSEGEAALEVYHQGDEEAKIQKILSVDKLPEINSLEDPFHREMLESIS
SIAYIQKNNGPMGCHRYIISNNQSVLHVLEVYQLNKLLLANGGDLFLDIVPLFETIDDLA
AAHSVMSSLYNNKTYRDHLRKRGNKQSIMLGFSDGTKDGGYIRANWSILRAKEELTKVAR
EEGIDVVFFDGRGGPPARGGGNTHNFYASLGPNVENREIQITIQGQTISANYGKPVSCSY
NLEQLLSAGMESHLYPSSENSLTDKQKSLIDEMADISYNAYKELKNHEQFVPYLEKVTPL
KFFGMTNIGSRPVKRSKGGSMKFEDLRAIPFVGAWAQMKQNIPGFFGVGKAIEELEKQGR
LGEVQQLYKDSLFFRSLLGNSMQSLAKSFYPATAYLKDDPQFGGFWELMYGEYQRSYDKI
LSVAGMSTLLEDSPLSKESIAIRERIVLPLITIQQYAIQTILEKGKEDTALQKLILRTMF
GIINAARNAA
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggctaacatctacgagactgaagtcgcaaagcgtttcacgatttataacagtctgttt
ttagacctgccctttgaccaaatatatagaacaggcacattgttgccgatcttatctgag
gcatgccaaagtgggtttcaagaaaataaaacgccaaaggaaattatccgccaattcttt
gaagaattaatggccgataaacctgaagaagaaaggcatgatcttctttttaaaatggta
caatacatcgaacgtcaggtagtgttatttgactcgatagaagatgcctccttcgaaaaa
ttcaatgacatcaaaggtaaaggtaccatgacggcattgattgccagagcggagaatgac
cataaaaaggaagaactcatagaaaagttgaagaacttttctgttcgactgacacttacg
gcacacccaacgcaattttatcctgggaatgttctggcgattatcactgatctggagcaa
gcaataaggaaaaatgaccttggtgatgtggatcttttgcttcgccaattgggtaaaaca
gctttcattaacaaagagaagccttctccttatgaagaggctgtaagtttaacctggttt
ttggagtatgtgttttatccgagcatatcggatatcatgatcagaatcctcaaccaactg
aatattccgctacatgattgggagaatcccaatttgctaaaagtgggtttttggccaggt
ggtgacagggatggtaatcctttcgttactcatgaaatcactaaaaaggtttctgacaag
ctacaaaacagcattcttaagtgttactatagagatatacgtaaggtaagaagaagatta
acctttcataatgttgaaagtcatcttattaaagcagaaaaaggtatatacaatacttta
ttcagtggagagggtgaggttttccattctaaagatgaattactagctgttttatatgag
gctagaaaaggcataatagaagagcatggtggcttgtcacttgaattgctggatgagttc
attcttaaagtgagggtatttgggttccattttgccagcatggacgtgaggcaagacagt
aggaaacacgatgccctttgggatgagattttagagaaaagtgaaggagaggctgctttg
gaggtttaccatcaaggggatgaggaggcgaaaatccaaaaaatcctttctgttgataag
ttgccagaaatcaattctctggaagatccatttcatagagaaatgctggagagcatttcc
tctatagcctacattcagaaaaacaatggacctatgggttgccacaggtacattatttcc
aataaccagtctgtactgcatgttttggaggtctatcagttaaataaattactacttgca
aatggtggtgatttgttccttgatattgtgcctttatttgaaaccattgacgatttggct
gctgcacacagcgttatgtcatctctttataacaataaaacttacagagaccaccttcgt
aagcgaggaaacaagcaatcgattatgttgggcttttctgatggaaccaaagatggtggt
tacatcagggccaactggtctatattaagggctaaggaagagcttaccaaagtggcaaga
gaggaagggatagatgtagtcttctttgatgggagaggtggaccgcctgcaaggggtggg
ggaaacactcataacttctatgcttctctcggacccaatgtggaaaaccgtgaaatccag
attaccatacaaggacagaccattagtgccaattatggcaagccagttagttgctcttat
aatttagaacaattacttagtgctggcatggaaagtcatttgtatccttcaagcgaaaac
agtttgactgataagcaaaagtcgcttatcgatgagatggccgatatcagttataatgct
tataaagagcttaagaaccacgaacaatttgtaccgtatttggaaaaagttactccattg
aaattctttggaatgaccaatataggatccagaccggtaaaaagaagcaaaggcggtagc
atgaaatttgaggatttgagagccataccttttgtaggcgcttgggcccaaatgaagcaa
aatattccaggtttctttggcgtgggtaaagccatagaagagttggaaaaacaaggcagg
ttaggagaggtgcagcagttatacaaagattctttgtttttccgctcactattggggaat
tccatgcaatcccttgccaagtccttttatccagcaacagcttacctcaaagatgatcca
caattcggaggtttctgggagttgatgtacggtgagtaccaaagatcttatgataagatt
cttagtgtggccggtatgagcaccttgctagaggacagtccattgagtaaagaatccatt
gccatcagggaaaggattgttttaccattgatcactatacagcagtatgctatccagacc
atattagaaaaaggaaaagaagataccgccttacaaaagttaatcctaagaaccatgttt
ggaatcattaatgccgcaagaaatgctgcttaa

DBGET integrated database retrieval system