KEGG   Cyclobacterium amurskyense: CA2015_3667Help
Entry
CA2015_3667       CDS       T03993                                 

Definition
(GenBank) Sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00511  Other glycan degradation
camu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:camu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CA2015_3667
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CA2015_3667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:camu02042]
    CA2015_3667
Enzymes [BR:camu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CA2015_3667
Bacterial toxins [BR:camu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CA2015_3667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10 BNR_assoc_N
Motif
Other DBs
NCBI-ProteinID: AKP53044
UniProt: A0A0H4PFQ3
LinkDB All DBs
Position
4465872..4467422
Genome map
AA seq 516 aa AA seqDB search
MKKIEIFNLNLLLGISLIISFYACGEKQDFPINEKIIFQQVYVPVIQGKTTTIAKLEIKT
EQQEMLNGLEIELQGDIDFTSLSINLLLEDGTKESLQGTFNKEEKSWSLTEEKSLPTGKL
AMNINVDLAENADLKGRFSLQVPMIEISGEKVQPSGQKENLAYRIGKSLRTEGDDGVAAF
RIPGLATSTKGTLLAVYDVRHDDSSDLQGNIDVGLSRSEDGGNTWNPMQIIMDMGEWGNL
PEDQNGIGDPSILVDPVNGDIYVVALWLHGKPGTAAWRSSEPGLTPDKTGQLMIVKSEDD
GKTWTAPSNITQPMKDASWQLFFNGPGKGIAMKDGTLVFAAQYKDHDQIPHSTIIYSKDH
GVSWQVGTGARSKTTEAQVVELSDGQLMLNMRDDRGGSRAVYTTVDMGNSWNEHSSNRGA
LVEPICMASLIRFNSEYLLFSNPASTEGRYNITVKASDDEGITWPEKYQVLLDDQKGWGY
SCMTKINEGEIGILYESSQAHMTFQILPINEIISSE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgaaatttttaacctaaaccttctattaggaatctctctgataatcagt
ttttatgcctgtggtgaaaaacaagattttccaatcaatgaaaaaataatttttcaacag
gtatatgttcccgtaattcaaggcaagacgactacaatagccaaacttgaaattaaaaca
gaacagcaagaaatgctcaatggccttgaaatagagttacaaggcgatattgattttacg
agtttatcaataaatttgctgttagaggatggtacaaaagaatcgcttcaaggaacattt
aataaagaagagaaatcttggagcttgacggaggaaaaaagcctgcctactggaaaattg
gccatgaatattaatgttgatctagcagaaaatgcagatctaaaaggtagattcagttta
caagttccaatgatagaaatctctggtgaaaaagtacagcctagtggtcagaaagagaat
ttagcctacagaatagggaaatcgcttcgtactgaaggtgatgatggagtggcagccttt
cgaattcctggacttgccacgagtacaaaaggtaccttgctggctgtttatgatgttaga
cacgatgattcctctgatttgcaaggaaatatagatgtgggcttgagtaggagtgaagat
ggaggaaatacatggaatcctatgcaaattataatggatatgggtgaatggggaaatttg
cctgaggaccaaaatggaattggagatccttctattttggtagatccagtcaatggagac
atttatgtggttgcgctttggctacatggtaagcccggaacggcagcttggagaagttca
gaacccggattgacaccagataaaacgggtcaattgatgattgtgaaatctgaggacgat
ggtaagacctggacagccccgtccaatattacccaacctatgaaggatgcctcatggcaa
ttgttctttaatgggccgggaaaaggaatagccatgaaagatggaacattggtctttgct
gctcaatacaaagaccatgatcaaattccgcacagtaccattatttacagtaaagaccat
ggtgtgtcatggcaagtgggaacaggagcaaggtcaaaaactactgaagcccaggtcgta
gagttaagtgatgggcaattaatgctaaatatgagagatgatcgaggtggttctagggcg
gtttatactacagtggatatgggcaattcctggaatgaacattcatctaaccgtggcgct
ttagttgaaccaatttgcatggctagcttaatcaggttcaattctgaatacctgttattt
tctaaccccgcatcgactgaaggtcggtataatattactgtgaaagcaagtgatgatgag
ggaataacctggcctgagaagtaccaagtattgctagatgaccaaaaaggttggggctac
agttgtatgacaaaaataaatgaaggtgaaattgggatattatacgaaagtagtcaagct
catatgacttttcaaattttaccaattaatgaaataatttcatctgaatag

DBGET integrated database retrieval system