KEGG   Cyclobacterium amurskyense: CA2015_3736Help
Entry
CA2015_3736       CDS       T03993                                 

Definition
(GenBank) Sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00511  Other glycan degradation
camu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:camu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CA2015_3736
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CA2015_3736
Enzymes [BR:camu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CA2015_3736
Bacterial toxins [BR:camu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CA2015_3736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-ProteinID: AKP53111
UniProt: A0A0H4PF63
LinkDB All DBs
Position
4582102..4583259
Genome map
AA seq 385 aa AA seqDB search
MINFIIYLISFFFTEATSPKDNVQVNPVSEQVLFVAGEGGYHTYRIPSLIVAADGSVLAF
VEGRKTGSSDTGDIDVLMKKSTDGGLTWSKQKVIWDKGETVCGNPNPVLDETTGEIHLLL
TWNRGDDHEGDIITKKSKNTRRVFVMKSTDNGDSWTEPSDITKTTKDPSWGWYATGPGVG
VQIKHGLNKGRLVIPANHSYDDPKGNVRGGPYEYGSHVIYSDDLGATWALGGTIKPKMNE
SQLIEMADGKGTLLMNMRSYFGKNRRALSVSNDGGVSWSDPVEATSLIEPVCQAAFIRYS
WPDDKAEDLVLFSNPASTKRENMTIKLSKDSGKTWIASKVLNQGPSAYSALAALPNGEIL
CLYEKGEKNPYEKLVLARLSLDNLQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgataaattttataatctatttaatctctttctttttcacggaagctacttcccctaaa
gacaatgttcaagtaaaccctgtttcagagcaagttttatttgttgcaggagaaggaggt
taccatacttaccgaattccctcactcattgtagctgcagatggctctgtattggcattt
gttgaggggagaaaaactggaagttcggacactggagacattgatgttttaatgaaaaag
tcaacagatgggggacttacctggtccaagcagaaagtaatatgggacaaaggagaaacg
gtgtgtggaaaccctaaccctgtgttggatgaaactacgggagagatccatttattactc
acttggaatagaggagatgatcatgaaggagacataattaccaagaaaagcaagaacacc
cgtagggtatttgtaatgaaatccactgataatggtgacagttggaccgaaccatcagac
attaccaaaacgaccaaggatccatcttggggttggtatgctactgggccaggtgttggg
gtacaaattaagcatggtctcaataaaggtcgcttggtgattccggccaatcacagttat
gacgatcctaaggggaacgtaaggggagggccttatgaatacggttcccatgtgatttat
agtgatgatcttggagctacttgggcacttggtggaaccatcaagcctaagatgaacgaa
agtcagctgattgaaatggcagatggcaaaggaacactattaatgaacatgcggtcttat
tttggtaaaaataggagagctttgtctgttagcaatgacggtggtgtttcttggtctgat
ccagtggaggcaacttctttaattgagccggtttgccaagcagcctttataaggtattcc
tggccagatgataaggccgaagatttggttttattttccaatccggcaagcactaaaaga
gaaaacatgaccatcaagctaagcaaggatagcggtaaaacttggattgcatctaaggtt
ttaaaccaaggcccttccgcttattcggctttagccgctttgcccaatggagaaattctt
tgcctatatgaaaaaggagaaaaaaatccttatgaaaagttagtgttagcacgtttgtct
ttggataacctgcagtaa

DBGET integrated database retrieval system