KEGG   Campylobacter sp. RM6137: CSUIS_0949Help
Entry
CSUIS_0949        CDS       T05900                                 

Definition
(GenBank) amino acid ABC transporter, periplasmic cysteine-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
camy  Campylobacter sp. RM6137
Pathway
camy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:camy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CSUIS_0949
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:camy02000]
    CSUIS_0949
   02035 Bacterial motility proteins [BR:camy02035]
    CSUIS_0949
Transporters [BR:camy02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    CSUIS_0949
Bacterial motility proteins [BR:camy02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    CSUIS_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd NMT1 DUF4354 DUF2706
Motif
Other DBs
NCBI-ProteinID: ARR00762
UniProt: A0A1X9SWW7
LinkDB All DBs
Position
935791..936540
Genome map
AA seq 249 aa AA seqDB search
MRNIFAILFMAFIFIGCSGDKSVKDKLRVATEGTYNPFSYHDESGKLVGYDVEVIAEAAK
RAGFEIEFHETNWDAIFSGLNSNRFDMIANQISDADPKRAELYTLSDPYIVTSAAIAVRA
DDNSINSLNDIKGKNIAQSMGSNYYEMAIQNGANIVLVDGLAPAIKAVSQGRADATMNDK
LAILNYIKTTGDKNIKVAFNTGDGTRSVFLFKKELTEQRDRINKALETMKKDGTLKQISE
KYFGMDVSE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatatctttgctattttatttatggcttttatctttattggttgttctggagat
aagagcgtaaaggataaattaagagtcgctacagaaggcacatataatccattttcatat
cacgatgaaagcggtaaattggtaggttatgatgttgaagtaatagctgaagcagccaaa
agagctggatttgagatcgaatttcatgagacaaactgggatgcgatattctcagggtta
aactcaaatcgctttgatatgatagctaatcaaattagcgatgctgacccaaaaagagct
gagctttacacacttagcgatccatatatagttacttcagcagctatagcagtaagggct
gatgataatagcataaactcgctaaatgatataaaaggcaaaaatatcgcccaatcaatg
ggaagtaactactatgagatggctatccaaaatggtgcaaatatcgtcttagttgatggc
ttagccccagccattaaggctgtaagtcaaggtagagcagacgctactatgaatgataaa
ctagctattttaaactatattaaaacaactggagataaaaatattaaggttgcatttaat
acaggcgatggcactagaagtgtatttttatttaaaaaagagctaacagaacaaagagat
agaatcaataaagcattagaaactatgaaaaaagatggcacactaaagcaaatttcagaa
aaatattttggaatggatgttagtgagtag

DBGET integrated database retrieval system