KEGG   Cyanobacterium aponinum: Cyan10605_1164Help
Entry
Cyan10605_1164    CDS       T02376                                 

Definition
(GenBank) Restriction endonuclease, type II, ApaLI
Organism
can  Cyanobacterium aponinum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI Omptin
Motif
Other DBs
NCBI-ProteinID: AFZ53286
UniProt: K9Z263
LinkDB All DBs
Position
complement(1410708..1410896)
Genome map
AA seq 62 aa AA seqDB search
MFYYPQREQAIKIQQTLETVYKGVNGEYYAGEQAWNFIRNRTGFDLKQILIDIADQKTPE
KS
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgttttattatcctcaaagagaacaagctatcaagattcaacaaactttagaaacagtt
tacaagggtgtaaatggcgaatattatgctggagaacaagcatggaattttattagaaat
cgtacaggatttgatttaaaacagattttaatagatattgccgatcaaaaaacaccagaa
aaaagttaa

DBGET integrated database retrieval system