KEGG   Cyanobacterium aponinum: Cyan10605_1716Help
Entry
Cyan10605_1716    CDS       T02376                                 

Definition
(GenBank) leucine-rich repeat-containing protein
  KO
K13730  internalin A
Organism
can  Cyanobacterium aponinum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 DKNYY LRR_6
Motif
Other DBs
NCBI-ProteinID: AFZ53819
UniProt: K9Z3V8
LinkDB All DBs
Position
2051483..2052322
Genome map
AA seq 279 aa AA seqDB search
MSLIKKSLFVASVIISPLIYSPIQVNAQNSNMSFSQWCEQQSLSAETEKTINAITKALNV
KNCAEAAEIAPRVFTLTIANQNISDLRPLKSFINLTDLNLYNNNIVDISPLQSMTNLKKV
VLGHNPIQDLTPLKSLNNLEKLYISNINTNNFEAIKYLKKINTLYINQNKISDLKPLENL
TNLQELYARENKISDLKPLANLTNLQELSLDNNQISDLTPLAKLSKLEELSLNNNQVTEA
GIKPLWDLKNLERVYLHQNPVARQFCPNNRDSLCFIGNR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaattaaaaaaagtttatttgttgccagtgtaattatttcccctcttatttat
tcaccgatacaagtgaatgcacaaaattcaaacatgagttttagtcaatggtgcgaacaa
caatcattatctgctgaaacagaaaaaaccattaatgcaatcactaaggctttaaatgta
aaaaattgtgcagaagccgctgaaatcgcccctagagtattcaccctaactatagcaaat
caaaatatttccgacttaagaccactcaaaagttttatcaatcttacagacttaaatcta
tacaataacaatattgtcgatatttcccctctacaatcgatgactaatttaaagaaagta
gttttaggtcataatcccattcaagatttaacccctttaaaatcattaaataacctcgaa
aaattatatatcagcaatattaatactaataattttgaagcaattaaatatctaaaaaaa
attaatactttatatattaatcagaataaaatcagtgatttaaaaccactagaaaattta
actaacttacaagaattatatgctagagaaaataaaattagcgatttaaaacccttagca
aatttaactaacttacaagaattatcgttagataataatcaaatttctgatttaactcct
ttagcaaaactgagcaaactagaagaattatctctcaataacaatcaagtaacagaagca
ggaatcaaacccctgtgggatttaaaaaatttagaaagagtatatctacatcaaaatcca
gtagcacgacaattttgccccaacaacagagatagtctttgttttatcggtaatagataa

DBGET integrated database retrieval system