KEGG   Cyanobacterium aponinum: Cyan10605_2057Help
Entry
Cyan10605_2057    CDS       T02376                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
can  Cyanobacterium aponinum
Brite
Enzymes [BR:can01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cyan10605_2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFZ54146
UniProt: K9Z4N7
LinkDB All DBs
Position
complement(2479841..2480443)
Genome map
AA seq 200 aa AA seqDB search
MAYQLPNLPYEYNALEPYISKSTLEFHHDKHHAAYVNKFNDAVAGTELDNQPIETIIKKF
AEDTSKQGIFNNAAQAWNHSFYWQCMKPNGGGNPTGVLADKINTDFGSFEKFIEAFKNAG
ATQFGSGWAWLVLDGDTLKVTKTPNADNPFTKNQIPLLTMDVWEHAYYLDYQNRRPDYIN
DFIEKLVNWDFVAQNFSEAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaattaccaaatctcccctatgaatacaatgctttagaaccctatatttct
aaaagtaccttagaattccatcatgataaacaccatgccgcctatgtgaataaatttaat
gatgccgttgctggtacagaattagacaaccaacccatagaaactattatcaaaaaattt
gctgaagacacttccaaacaaggaatttttaataatgccgcccaagcatggaatcacagt
ttttattggcaatgtatgaaacctaatggtggaggtaatcccactggtgttttggcagat
aaaatcaacacagattttggttcttttgaaaaatttatagaagcctttaaaaatgccggt
gctactcaattcggtagtggttgggcatggttagtgttagatggagacactttaaaagtt
acaaaaacaccaaatgctgataatccttttactaaaaatcaaattcctcttttaacaatg
gatgtttgggaacacgcttactatttagattatcaaaatcgccgtcctgactacatcaat
gattttatagaaaaattagttaattgggatttcgttgcacaaaatttctctgaggcactt
tag

DBGET integrated database retrieval system