KEGG   Cyanobacterium aponinum: Cyan10605_2512Help
Entry
Cyan10605_2512    CDS       T02376                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
can  Cyanobacterium aponinum
Pathway
can00400  Phenylalanine, tyrosine and tryptophan biosynthesis
can01100  Metabolic pathways
can01110  Biosynthesis of secondary metabolites
can01130  Biosynthesis of antibiotics
can01230  Biosynthesis of amino acids
Module
can_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:can00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan10605_2512
Enzymes [BR:can01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Cyan10605_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB IGPS
Motif
Other DBs
NCBI-ProteinID: AFZ54593
UniProt: K9Z887
LinkDB All DBs
Position
complement(2989771..2990829)
Genome map
AA seq 352 aa AA seqDB search
MIVVMKVGTPEPEITRVSDELATWGLTPEKIVGQHKVVIGLVGETASLNPEQIQEISPWI
ESVLRVEQPFKRASLDYRHGQPSDVVVPTPNGDVVFGLNHPVVVVAGPCSVENEEMIVET
AKRVKAAGAKFLRGGAYKPRTSPYAFQGHGESALELLAAAREATGLGIITEVMDTADLDK
IAEVADVLQVGARNMQNFSLLKKVGAQSKPVLLKRGMSATISEWLMAAEYILAGGNSNVI
LCERGIRTFDREYARNVLDLSVIPVLRSLTHLPIMIDPSHGTGKAEYVPSMAMAAIAAGT
DSLMIEVHPNPAKALSDGPQSLTPDRFAQVMQELSVIGKTLNRWESPEAVLA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgattgttgtaatgaaagtggggactccagaaccagaaatcactcgtgtaagtgatgaa
ttggcaacatggggtttaacacctgaaaaaatcgttggacaacacaaagttgtaattggt
ttagtgggagaaactgcttccctaaatcctgaacaaattcaagaaattagtccttggatt
gaaagtgttttaagagttgaacaacctttcaaaagagccagtttagattatcgtcatgga
caacctagcgatgtagttgtacctactcctaatggcgatgtagtttttggtttaaatcat
cctgtggtagtggtagcaggtccttgttcggtagaaaatgaggaaatgattgttgaaacc
gcaaaacgagtcaaagcggcaggggcaaagtttcttagaggtggtgcttataaaccaaga
acctctccttatgcttttcagggacatggggaaagtgctttagaattattagcggcggcg
agagaagcaacgggattaggaattatcacagaagtcatggatactgctgacttagataaa
attgctgaagtggcggatgtcttacaggtgggagcaagaaatatgcaaaatttctctctc
ttgaaaaaagttggagctcagtctaaacctgttctcttaaaaagaggaatgtcggcaact
attagtgaatggttaatggcggcagaatacattttagcagggggtaattctaatgtaatc
ctttgtgaacgtggtattcgtactttcgatcgagaatatgctcgtaatgtccttgatttg
tctgtaattcccgttttacgttctctaactcacttaccgattatgattgatcctagtcat
ggtactggtaaggcagaatacgttcctagtatggcaatggctgcgatcgcggcaggtaca
gattctttgatgatagaagtacatcctaaccctgcaaaagccttatcagatggtcctcaa
tctttgactcctgatagatttgctcaagtaatgcaggaattatctgttattggtaaaact
ttaaatcgttgggaatcccccgaagcagtattagcttaa

DBGET integrated database retrieval system