KEGG   Cyanobacterium aponinum: Cyan10605_3401
Entry
Cyan10605_3401    CDS       T02376                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
can  Cyanobacterium aponinum
Pathway
can00010  Glycolysis / Gluconeogenesis
can00020  Citrate cycle (TCA cycle)
can00620  Pyruvate metabolism
can01100  Metabolic pathways
can01110  Biosynthesis of secondary metabolites
can01120  Microbial metabolism in diverse environments
can01200  Carbon metabolism
Module
can_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:can00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan10605_3401
   00020 Citrate cycle (TCA cycle)
    Cyan10605_3401
   00620 Pyruvate metabolism
    Cyan10605_3401
Enzymes [BR:can01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan10605_3401
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF4781 PYNP_C PASTA MadL
Other DBs
NCBI-ProteinID: AFZ55443
UniProt: K9ZAM2
LinkDB
Position
4018705..4020030
AA seq 441 aa
MIYDIFMPALSSTMTEGKIVSWEKQPGDKVEKGETVVVVESDKADMDVESFYSGYLATIL
VPAGSQAPVGDAIAYIAETEAEIEEAKKKASQAQGGNNVTSTPATTPEFKKEVETSPQPV
ATTANTEISPSNTSENNGRIIASPRAKKLAKEFKVDLATIKGSGVNGRITAEDVEKAVGK
APSVTTSTPSLPTITSSIPPQITPTPALGNAAPINNLAGETVPFNTLQQAVVRNMVASLH
VPTFQVSYDITTDALDGLYRKIKTKGVTMTALLAKAVAVTLQKHPIMSATYTEGGIKYND
SINIAVAVAMPDGGLITPVIKNAAQIDIYSLARSWKDLVDRARAKQLQPDEYSTGTFTLS
NLGMFGVSSFTAILPPGQGSILAIGGTRPAVVASKDGLFGVKNQMTVTITCDHRIIYGAD
AASFLKDLANLIENDPHSLTL
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgatttacgatatatttatgccagccctcagttccacgatgacagaagggaaaatagtt
tcatgggaaaaacaacccggtgataaagttgagaaaggagaaactgttgttgtcgttgaa
tccgacaaggctgatatggatgtagaatctttctactctggttatttagctactattctt
gtccctgccggttctcaagctcctgtgggagatgcgatcgcatatattgctgaaaccgaa
gcagaaatagaagaagccaagaaaaaagccagtcaagcacaagggggaaataatgtcact
tcaacccccgcaactactcctgaattcaaaaaagaagtagaaacctctcctcaacctgtg
gcaaccactgctaacacagaaatctctccctcaaatacttctgaaaataacggtagaatt
atcgcttcccccagagcaaaaaaattagccaaagaatttaaagttgatttagccactatt
aagggtagcggtgtcaacggtagaattaccgccgaagatgtagaaaaagcggtcggaaaa
gcacctagcgtaaccacatctactccttcattgcccaccattacatcctctatacctcct
caaattacccccactcctgccctcggtaatgccgctcccattaataatttagcaggagaa
accgtaccttttaacaccttacaacaagcagttgttcgtaatatggtggctagtttacac
gttcccactttccaagttagctatgatattaccactgatgctttagatggcttatatcgt
aaaatcaaaactaagggagttacaatgactgcattattagccaaagctgttgcagttacc
ctacaaaaacaccccatcatgagtgctacttatacagaaggtggcattaaatataacgat
tctatcaacatcgctgttgccgttgcgatgcccgatggcggtttaattacccctgtgatt
aaaaatgcggctcaaatagatatttattcccttgcccgtagctggaaagatttagtagat
cgtgccagagcaaaacaactacagcctgatgagtacagtacaggtacatttactctttct
aatttagggatgtttggtgtaagtagctttaccgctattttacctcccggacaaggttcg
atcttagccattggtggtactcgccccgccgtagtagctagtaaagacggtttatttggg
gttaaaaatcaaatgacagtgactatcacctgtgatcaccgtatcatctatggtgcagat
gcggcatcattcctcaaagatttagctaatttaattgaaaatgatccccattctttgaca
ttgtag

DBGET integrated database retrieval system