KEGG   Capsicum annuum: 107840969Help
Entry
107840969         CDS       T04646                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cann  Capsicum annuum
Pathway
cann00010  Glycolysis / Gluconeogenesis
cann00051  Fructose and mannose metabolism
cann00052  Galactose metabolism
cann00500  Starch and sucrose metabolism
cann00520  Amino sugar and nucleotide sugar metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
Module
cann_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cann_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107840969
   00051 Fructose and mannose metabolism
    107840969
   00052 Galactose metabolism
    107840969
   00500 Starch and sucrose metabolism
    107840969
   00520 Amino sugar and nucleotide sugar metabolism
    107840969
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107840969
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cann04131]
    107840969
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107840969
Membrane trafficking [BR:cann04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107840969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Spore_III_AB
Motif
Other DBs
NCBI-GeneID: 107840969
NCBI-ProteinID: XP_016540421
UniProt: A0A1U8E1X6
LinkDB All DBs
Position
9
AA seq 499 aa AA seqDB search
MGKLVVCVAVVCTAAVCGAAAVLLMMRRMKNCGEWGKAMAMLKEFEEKCATPVEKLRQVA
DAMSVEMHAGLASEGGSKLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVMRVQLGGKEN
RIVKHEVKEVSIPQNVMAGSSSDVLFDFIATALAEFVATEGDDFHLPPGRQRELGFTFSF
PVKQLSIASGTLIKWTKGFSIEDVVGQDVVGELTKAMERVDLDVRVAALVNDTVGTLAGG
RYNNPDVIAAIILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFHSTHLPVTEY
DQNLDAESLNPAEQIYEKMISGMYLGEILRRVLCRMAEEASLFGDYVPQRLKIPFILRTP
DMAAMHHDESADLKVVGNKLKDILEVPNSTLKTRKIVVELCDIITSRGAHLSAAGIVGIL
KKLGIDTLKNGEKHRSVVAVDGALFEHYTKFRNCMEGTIKELLGDAADSIVIELSSDGSG
VGAALLAASHSQYLGLDES
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattggtagtgtgtgtagcagttgtatgtactgcagcagtatgtggtgctgca
gcagttttgttaatgatgaggaggatgaagaattgtggtgagtggggaaaggctatggct
atgttgaaagagtttgaggagaagtgtgcaactccagtagaaaaacttaggcaagtggct
gatgctatgagtgtagagatgcatgctggacttgcttctgaaggcggaagtaaacttaag
atgcttattagctatgttgataatctccctactggggacgaacaaggtctgttttatgca
ttggatctaggcggtacaaacttccgtgtgatgcgtgtgcagttgggtgggaaagaaaac
cgtatagttaaacatgaagttaaagaagtttcaattccacagaatgtgatggctggatca
tcatccgatgtgttatttgattttattgccacggcacttgcagaattcgtagctacagaa
ggtgatgattttcatcttccacccggtagacaaagggagttaggctttaccttctctttc
ccagtgaaacaattgtcgattgcatcaggaactcttattaaatggacaaagggcttctcc
atagaagatgtggttggccaagatgtggttggggaattaacaaaagcaatggaaagggtc
gacctcgatgtgcgtgtggctgctttagtcaacgatactgttggaacgttagcaggaggt
cggtacaataatcctgatgtcattgctgccataatattgggtactggaaccaatgcagca
tatgttgagcgggcacacgcgattccgaaatggcatggcctgctgccgaaatcaggagag
atggtaatcaacatggaatggggtaatttccattcgacacatcttccagtaacagaatat
gaccaaaatcttgatgctgagagtttaaaccccgcggaacagatttatgagaagatgatt
tctggcatgtatctcggagaaattttgcgtagagtattgtgtagaatggctgaagaagct
tcattattcggtgattatgtaccacagagactgaaaattccgttcatattgaggactccg
gacatggctgctatgcatcacgacgagtctgctgatctcaaggtggttggcaataagttg
aaggatatcttagaggtgcctaattctaccttgaaaacgaggaaaatagttgtggagcta
tgcgacattatcacctctcgtggagctcatctttctgcagcagggatcgtggggatcctc
aagaaattaggaatagacactttgaagaacggagagaagcataggtctgtcgtagctgta
gatggtgcattgttcgagcattacacaaagttcagaaattgcatggaaggaactattaaa
gagttactgggagacgccgctgacagcatagtcattgagctctcgagcgatggttcaggc
gttggcgcagcacttttggctgcatctcattcacaataccttggacttgacgaatcttga

DBGET integrated database retrieval system