KEGG   Capsicum annuum: 107842536Help
Entry
107842536         CDS       T04646                                 

Definition
(RefSeq) transcription factor bHLH140
  KO
K10863  aprataxin [EC:3.1.11.7 3.1.11.8 3.1.12.2]
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cann03400]
    107842536
Enzymes [BR:cann01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.7  adenosine-5'-diphospho-5'-[DNA] diphosphatase
     107842536
    3.1.11.8  guanosine-5'-diphospho-5'-[DNA] diphosphatase
     107842536
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.2  DNA-3'-diphospho-5'-guanosine diphosphatase
     107842536
DNA repair and recombination proteins [BR:cann03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107842536
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     107842536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DcpS_C AAA_33 HIT Macro zf-C2HE AAA_18 Zeta_toxin CPT AAA_29 AAA_16 AAA_17 AAA_5 Viral_helicase1 AAA RNA_helicase NACHT KTI12 AAA_25 AAA_22 6PF2K
Motif
Other DBs
NCBI-GeneID: 107842536
NCBI-ProteinID: XP_016541927
UniProt: A0A1U8E3V1 A0A2G2YRT6
LinkDB All DBs
Position
9
AA seq 741 aa AA seqDB search
MGQFSGYTVEAMDVDPEPNLGGKDEAKEKPILVILVGAPGSGKSTFCDHVMRLATRPWVR
ICQDAIGNGKAGTKNQCLTAAASALKDGKSVFIDRCNLSREQRADFVKRVGPEVEKHAVA
LDLPAKLCISRSVKRTGHEGNLQGGKAAAVVNRMLQKKELPKLNEGYARITVCQDKKDVQ
AAINMYTALGPLDKLPPGFFGQKNSDSKVQQGIMKFLKKKDPPECSDAVVYIASENIQSH
ATKEKDSNQVLESCEEQKKTSVGSSISLENAPTLAFPSISTADFHFNLEKASDIIVEKVE
EYVNKLGNARLVLVDLSQNSKILSLVRAKAAEKNIDSKKFFTFAGNITNLYSDGGLHCNA
IANVTNWRLKPGGGGVNAAIFNAAGPALETATKAKAKSISSGKAIVVPLPSSSPLFSREG
VTHVIHVLGPNMNPQRPNCLNNDYVNGCKILRDAYSSLFDGFASIVRTQEELCKYSFEKI
TEGEVQLDQGSRNGGQKAKRETVCEADMNKKYKSFVKELGPNVGSSGDGSTGGQITKAWG
AWAQALYDTAMHPERHKNIIEMSDDVVVLNDLYPKAQKHLLVLARVESLDRLEDVHKEHV
TLLKTMHSVGLKWAEKFLSENSSLTFRLGYHSVPSMRQLHLHVISQDFDSNHLKNKKHWN
SFNSPFFRDSVDVIDEVSQNGKAVLKDENVLSMELRCHRCQSAHPNIPRLKAHISSCQAS
FPAFLLQNGRIVFSEGKDANS
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgggacaattctcgggttacaccgtggaagcaatggatgttgatcctgaacctaatttg
ggagggaaggatgaagcaaaagagaaacccatactggtaatactggtgggagctccagga
agtggtaagtccaccttttgtgaccatgttatgcgactcgctactcgcccctgggttcgt
atttgccaggatgccattgggaatggcaaggctgggacaaagaatcaatgcttgacagct
gcagctagtgcgctaaaggatggcaaaagtgtatttatagatagatgcaacttaagcaga
gaacagcgggctgacttcgtgaagcgtgttggtccagaagttgagaagcatgctgtggca
cttgatctcccagctaagctttgcatttctcggtcggttaagaggacagggcatgaagga
aacttgcaaggtgggaaagctgctgcagttgtgaataggatgctgcaaaagaaagagttg
cctaagctgaatgaaggatatgctcgaattacagtttgccaagataaaaaagatgttcaa
gctgctatcaatatgtacactgcacttggtccattagataaacttccaccaggatttttt
ggccagaagaactcagattccaaagtccaacaaggtataatgaagttcctcaagaaaaag
gatcctcctgaatgttctgatgctgtggtgtatatcgcttcggagaatattcaatctcat
gccaccaaggaaaaggattccaaccaagtactagaaagctgtgaagaacagaagaagaca
tctgttggcagtagtatttccttagaaaatgcccccacacttgcatttccatctatttct
acagcagatttccatttcaatcttgaaaaagcatcggacataatagttgagaaggttgag
gagtatgtaaataagctcggaaatgctaggcttgtcttggtggatttgtctcagaattca
aaaatactctcccttgtcagggctaaagctgcagagaagaatattgactcaaaaaagttc
tttacgtttgcaggaaatataactaatctttactcagatggaggtttgcactgcaacgcg
attgctaatgtcactaactggcgactaaaaccaggaggtggaggtgtaaatgctgctata
tttaatgccgctggtcctgcccttgaaactgcaaccaaagctaaagctaaatccattagt
tctggaaaagctattgttgtccctcttccttcctcttctcccttgtttagtagggaagga
gttactcatgtcatacatgtccttggaccaaacatgaatcctcagagaccaaactgtctc
aacaatgactatgtcaacggttgtaaaattctccgggatgcttactcatcactttttgat
ggttttgcatcgatagttaggactcaagaagagctgtgcaagtatagttttgaaaaaata
actgaaggagaagttcaactagatcaaggttctagaaatggtggtcagaaagctaagcgt
gaaactgtttgtgaagcagacatgaacaagaagtataaaagctttgtgaaagaactcgga
ccaaatgttggaagttcaggtgatggaagcactggtggacagataacaaaggcatggggt
gcatgggctcaagctctttatgacactgcaatgcatcctgagaggcataagaatataata
gagatgtcagatgatgttgtagtactgaatgatctttatcccaaggctcagaaacacctc
ttagtgttagcacgtgttgaaagtcttgaccgtcttgaagatgttcacaaggagcacgtc
acattattaaagacaatgcacagtgttggcttgaagtgggcagaaaagtttctatcagaa
aacagttcgttgacattccgcctaggatatcattcggttccctcaatgcgtcagctgcat
cttcatgtgataagccaagactttgattccaatcatctgaagaataagaagcattggaac
tcattcaactcccccttcttccgggattcggttgatgtaatagatgaagttagtcaaaat
gggaaggccgttttgaaggatgagaatgtcctttccatggagctgaggtgtcatcgatgt
caaagtgcacatccaaacattcctcgccttaaagcacatattagttcttgtcaggcatcc
tttccagcatttttgctgcaaaatggtcgtatagttttctcagaaggtaaagatgcaaat
agctga

DBGET integrated database retrieval system