KEGG   Capsicum annuum: 107843204Help
Entry
107843204         CDS       T04646                                 

Definition
(RefSeq) dnaJ protein ERDJ2A-like
  KO
K09540  translocation protein SEC63
Organism
cann  Capsicum annuum
Pathway
cann03060  Protein export
cann04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107843204
   04141 Protein processing in endoplasmic reticulum
    107843204
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cann03110]
    107843204
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cann02044]
    107843204
Chaperones and folding catalysts [BR:cann03110]
 Heat shock proteins
  HSP40 / DNAJ
   107843204
Secretion system [BR:cann02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   107843204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ
Motif
Other DBs
NCBI-GeneID: 107843204
NCBI-ProteinID: XP_016542915
UniProt: A0A1U8E6Q0
LinkDB All DBs
Position
9
AA seq 681 aa AA seqDB search
MGASEENSALFPIFVLTLMALPLVPYTIVNLFGAFKKKAAKINCQCSVCVRSGKYHKSIF
RRISNFSTYSNLTLVLLWVVMAVLVYYIKHINTEVQIFEPFSILGVEYGASDSEIKKAYR
RLSIQYHPDKNPDPEAHSYFVEFISKAYQALTDPVSRENFEKYGHPDGRQGLQMGIALPQ
FLLNIDGASEGILLLGIVGVCIILPLTISVIYLSRSSKYTGNYVMHSTLAAYYHLMKPSL
APSKVMDVFIKASEFVDIPVRRSDEEPLQRLFVLVRSELNLDLKNIRQEQAKFWKQHPAL
VKTELLLQTQLTRETASLSPTLQRDFKRVLELAPRLLEELMKMAIIPRPPVGHGWLRPAI
GVMELSQSVVQAVPLSARKAAGGSSEGYAPFLQLPHFSEAVVKKIARKKVRTFQDFRDMT
PDERADLLTQVAGFSNSESHDVEMVLEMMPSVTIDIACETEGEEGIQEGDIVTMHAWVTI
KRGSGLIRALPHCPYFPFDKEENFWLMLADSFSNDVWLSQKVSFMDEATAIIAVSKTLQE
LKEGSGATPREINAAVKEAIEKVKNGSRLVMGKFQAPAEGNYNLSSFCLCDSWIGCDAKS
NLKLKVMKRSRAGTRGGFAADETPAMEDGIEEDEEEEEEDYDDYESEYSEDEEDAKEKTS
KGAVANGSARSGSDESGSEAD
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgggggcttctgaagagaacagcgcacttttccccatctttgtcttgacattaatggct
ctgccactagttccttacactatagtcaatttatttggtgctttcaagaaaaaggctgcc
aaaatcaactgccagtgttcagtctgcgttcggtctgggaaatatcacaaatccatattc
aggcggatttcaaacttctcaacgtacagtaatctgacccttgtactgctgtgggtcgtc
atggctgttctagtttattacatcaagcatatcaacactgaggtccaaatattcgagcca
ttcagtattcttggagtggaatatggagcttcagactctgaaataaagaaggcatatcgg
aggctttccattcagtatcatcccgataaaaatccagatccagaggcacactcatacttt
gttgaattcatctcaaaggcttatcaggctctgacagatccggtatctagggaaaatttt
gaaaaatatggccatcccgatggacggcaggggcttcaaatgggcattgccctccctcag
ttccttctgaacattgatggagcatccgaaggaatactgttgcttggaatagttggagtc
tgtataattctgcccttgacaatttctgttatatacttgtctaggtcgtcaaagtatact
ggaaactatgttatgcactcaacattagccgcatattaccatttaatgaagccttcttta
gcgccaagcaaggtcatggatgttttcattaaggcttctgaattcgtggatattcctgtc
cgtcggtctgatgaagaacctctgcagagactgtttgtcttagttaggagtgagctaaat
ctggatcttaagaatattcggcaagaacaggccaagttttggaagcagcatcccgcttta
gtaaagactgaattgttgcttcaaactcaattgacgcgtgagacggcatccttgtctcca
actttacagcgtgatttcaaacgcgttcttgaactcgcacctcggcttctggaagaattg
atgaagatggctattattccacgccctccggtggggcatggatggctaagacctgcaata
ggagtgatggaactgtctcagagtgttgttcaggcagtacctctcagcgcaaggaaagca
gcaggtggatccagtgaagggtatgcaccatttttgcagctgccacactttagcgaggct
gttgttaaaaagattgcgagaaagaaagttcgtacatttcaagacttccgcgacatgaca
ccagatgaacgtgctgatctgctgactcaagttgctgggttctccaatagtgaatcccac
gatgtggagatggttcttgaaatgatgccgtcagtgacaattgatatcgcatgtgagacc
gaaggcgaggagggaattcaagagggcgacatcgttaccatgcatgcttgggtcactatt
aagcgtggtagtggcttgatacgcgcccttccccattgtccgtattttccttttgacaaa
gaggagaatttctggttgatgcttgcggactccttttcgaatgatgtgtggctctctcag
aaggttagtttcatggatgaagctacagcaataattgctgtatcgaaaacacttcaggag
ttgaaggaagggtctggtgcaactccaagggaaataaacgctgccgttaaagaagcaatc
gagaaggtgaaaaatggttcaagactggtaatggggaagttccaagctccagctgaagga
aactacaacttgagctctttctgcttatgtgactcttggattggttgtgatgcaaagtcg
aatctaaagttaaaggttatgaaacgcagcagagctggaaccagaggtggattcgcagca
gatgagacacctgcaatggaggacggaattgaagaggacgaggaagaagaagaagaagat
tacgatgattatgaaagtgaatacagcgaagatgaagaagatgcaaaggaaaaaacgagt
aaaggagccgtggccaatggatcagcccgttcaggctcagatgaatctggttcagaagcc
gactaa

DBGET integrated database retrieval system