KEGG   Capsicum annuum: 107843945Help
Entry
107843945         CDS       T04646                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cann  Capsicum annuum
Pathway
cann00061  Fatty acid biosynthesis
cann00780  Biotin metabolism
cann01100  Metabolic pathways
cann01212  Fatty acid metabolism
Module
cann_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107843945
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    107843945
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    107843945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cann01004]
    107843945
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     107843945
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     107843945
Lipid biosynthesis proteins [BR:cann01004]
 Fatty acid synthase
  Component type
   107843945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 107843945
NCBI-ProteinID: NP_001311545
UniProt: B5LAU3 A0A1U8EBT1
LinkDB All DBs
Position
10
AA seq 392 aa AA seqDB search
MAANATPGLQIRATKQCISASHDISKLSNISFGFGSKRKSCKDFRSSSYISHTKPIHSFK
SVPIKFERMVTKAMSGANEQVPVSGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAE
ILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEIAKVYPLDAVFDCPEDVPEDVKTNK
RYAGSSKWTVTEVAESVKQDFGTIDILVHSLANGPEVIKPLSETSRKGYLAAISASSYSF
ISLLKHFLPIMNPGGATISLTYIASERIIPGYGGGMSSAKAALESDTKVLAFEAGRKHKI
RVNTISAGPLGSRAAKAIGFIDMMINYSLENAPLQKELYAEEVGNTAAFLASPLASAITG
ATVYVDNGLNAMAVGVDSPAFAGLDIPKDNKS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaatgcaactcctggcttgcaaattcgagcaaccaaacaatgcatttccgca
tctcatgatatttcaaaattgagcaatataagtttcggttttggaagtaaaagaaaatct
tgtaaagattttagaagttcgtcatatatctcgcacacgaagccaatccatagcttcaag
tctgttcctataaaatttgaaaggatggttacaaaagcaatgtctggagctaatgaacaa
gtgccagtttcggggttgcctattgatttgagaggtaagagggcatttattgctggcata
gcagatgacaatgggtatggatgggcaatagcaaagtctcttgcagccgcaggggctgaa
attcttgttgggacatgggtgcctgcattgaacattttcgagaccagtctgaggcgtggg
aagtttgatgaatcacgagtgttgcccgatggttcattgatggaaattgcaaaagtttac
ccattggatgcagtttttgactgtccagaagatgttcctgaggatgtgaaaacaaacaag
cgttatgccggatcctcaaagtggactgtcacggaagttgctgaatctgtaaaacaagat
tttggcactatcgacatccttgtacattcacttgcaaatggtccagaggttatcaaacct
ctatctgagacatcaagaaaaggataccttgcagctatatctgcctccagttattccttt
atatcgctactaaagcattttcttcccataatgaatcccggcggtgccacaatctctcta
acgtacattgcttctgaaaggattatccctggatatggaggcggtatgagttcggcaaaa
gctgctttggagagtgacacaaaagtcctggcgtttgaagccggaagaaagcacaaaatc
agagtcaacacgatatctgcaggtccactgggaagtcgtgcagccaaagctattggcttc
atcgacatgatgataaattactcattggagaatgctccgttgcagaaggagttatatgct
gaggaggttgggaacactgctgcttttctggcttcgcctttggcttcagcgatcactggt
gccacggtgtatgtcgacaatggtctgaatgcgatggcagttggagttgacagcccagca
ttcgcaggtctcgacatcccaaaagataataagagctag

DBGET integrated database retrieval system