KEGG   Capsicum annuum: 107847314Help
Entry
107847314         CDS       T04646                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cann  Capsicum annuum
Pathway
cann00010  Glycolysis / Gluconeogenesis
cann00020  Citrate cycle (TCA cycle)
cann00620  Pyruvate metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
Module
cann_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107847314
   00020 Citrate cycle (TCA cycle)
    107847314
   00620 Pyruvate metabolism
    107847314
Enzymes [BR:cann01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107847314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Allantoicase
Motif
Other DBs
NCBI-GeneID: 107847314
NCBI-ProteinID: XP_016546988
UniProt: A0A2G2YCC8 A0A1U8EIE7
LinkDB All DBs
Position
11
AA seq 448 aa AA seqDB search
MASLSFSASLGVRLTSTASTHRAPTTYKLPIIQSKIREIFMPALSSTMTEGKIVSWIKSE
GDVLTKGESVVVVESDKADMDVETFYDGILAAIVVNEGETANVGAPIGLLAENEDEVAEA
VARGKGKLVKDEIKAEGGQATVEIEKIKRVVVATPNAKKLAKQHKVDLNKVNGTGPYGRV
TSEDVEKAAGISTVSVPAKSVSSAAPAAATHTVPAAATVSLPEIPGSTIVPFTTMQAAVS
KNMVESLSVPTFRVGYPVVTDALDALYLKVKKKGVTMTALLAKAAAMALAQHPVVNSSCK
DGKSFTYNSSINIAVAVAINGGLITPVLQDADKMDLYLLSQKWKELVEKAKAKQLQPHEY
NSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPSVVANADGFFSVKNKMLVNVTAD
HRIVYGADLAAFLQTFSKIVENPESLTM
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcatcactttccttctccgcctccctcggcgtccgtctcacctccacagcttccact
catagagcaccaactacctacaaacttccgatcattcaatcgaaaattcgcgagattttc
atgccggcattgagctcaacgatgaccgaaggtaagatcgtatcgtggataaaatcagaa
ggcgatgtgttgactaaaggagaatcagttgtcgttgttgaatcggataaagctgatatg
gatgttgagacgttttacgatgggatattagctgctatcgttgttaatgaaggtgaaact
gcgaatgtcggtgcgcctattgggttgctagctgaaaatgaagacgaagttgctgaagct
gtagctagaggtaaaggtaagttggtaaaggacgagattaaagctgaaggaggacaagct
acggttgagattgagaagattaagagggttgttgttgcaactcctaatgcgaagaaattg
gctaagcagcataaggttgatttgaataaagttaatgggacgggtccgtatggacgtgtt
acgtctgaggatgttgagaaagctgctggaattagtacggtgtcggtgccggctaagagt
gtaagttctgctgctcctgctgctgctactcatactgttcctgctgctgctacggttagt
ttaccggagattccaggatcgacgattgttccgtttactacaatgcaagctgctgtgtcg
aagaatatggtggaaagtctctctgtacctacatttcgtgttgggtatcctgttgttacc
gatgcacttgatgctttatacttgaaggttaagaagaagggtgttacgatgactgcattg
ttggccaaagctgctgcgatggcacttgctcaacatccagttgtgaattcctcttgtaaa
gatggaaagagctttacgtataacagcagtataaatattgctgttgcggtggccattaat
ggcgggttgattacaccggtgcttcaggatgctgacaagatggatctgtatctgttatct
caaaagtggaaggaactagtagagaaggctaaggctaagcagcttcaaccacatgagtac
aattcagggactttcacgttatccaacttgggaatgtttggtgtggaccgatttgatgcc
attcttcctcctggccagggtgctataatggctgttggagcatcaaaaccgagtgttgta
gctaatgctgatgggttcttcagcgtcaaaaataagatgctggtgaacgtcacagcagat
caccgaattgtgtatggcgcggacttggcagccttccttcaaacgttttccaagattgtt
gagaatccagagagcttgacaatgtag

DBGET integrated database retrieval system