KEGG   Capsicum annuum: 107847775Help
Entry
107847775         CDS       T04646                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cann  Capsicum annuum
Pathway
cann03030  DNA replication
cann03410  Base excision repair
cann03420  Nucleotide excision repair
cann03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cann00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107847775
   03410 Base excision repair
    107847775
   03420 Nucleotide excision repair
    107847775
   03430 Mismatch repair
    107847775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cann03032]
    107847775
   03400 DNA repair and recombination proteins [BR:cann03400]
    107847775
Enzymes [BR:cann01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107847775
    6.5.1.6  DNA ligase (ATP or NAD+)
     107847775
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107847775
DNA replication proteins [BR:cann03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107847775
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107847775
DNA repair and recombination proteins [BR:cann03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107847775
   NER (nucleotide excision repair)
    Other NER factors
     107847775
   MMR (mismatch exicision repair)
    Other MMR factors
     107847775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase Npun_R1517
Motif
Other DBs
NCBI-GeneID: 107847775
NCBI-ProteinID: XP_016547744
UniProt: A0A2G2YHI0 A0A1U8EV20
LinkDB All DBs
Position
11
AA seq 859 aa AA seqDB search
MLSLRSCRYYKPLNPLYNHLNFTLKPSSISLLKPLFFSLNPKSTTMSSSSPPHPPPPPRS
AFAVLMANSKKKTPSQDSSPKKRKTPHVESSSKSSEVNQGSVLKPIKDTHLDNLSKSEEL
VVGKEGNQDSVLKPAEDTLLDKDSKNEALVKKKGNQDSVLKPIEDTQMVNESKNEVLVEK
KRNKDSVMKSIEGTQMVNESKSGELVAKKKRKMISPEESIVEIKKKAANFDPRKAAYWGD
GERVPFMFVVKAFDAISKESGRIVITEIATNMLRTVIETTPEDLLPVVYLSANKIAAAHD
GLELGVGDASIIKALAEACGAKEAHIKKQYKELGDLGLVAKASRSSQPLMHKPEALTVAK
VFDKFRIIAKESGKDSQEKKKNYIKSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLVAL
AHAFVYSDKHSSPPAGVDSPLEEAAKIVKQVYSVIPVYEKIVPALLADGVWKLSETCSFS
PGVPVGPMLAKPTKGVSEILDKFQDMEFTCEYKYDGERAQIHYMEDGSVEIYSRNAERNT
GKFPDVVAAISRLKKSSAASFVLDCELVAYDREKQKILPFQVLSTRARKNVVISEIKVNV
CIYAFDILYLNGQPLLQEQLNVRREHLYKSFEEEPGYFQFATAVASNDLEEITKFLEDAV
NGSCEGLIIKTLTTDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVY
GAFLLACYDNNNEEYQSICKIGTGFSEAMLEERSASLRSKVIPKPKSYYRYGETINPDVW
FEATEVWEVKAADLTISPVHRAAQGIVDPGKGISLRFPRLMRVREDKNPEEASSAEMVAD
MYNAQKHNHKNNQDDNDED
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgttatcattgcgttcatgccgttactataaacccttaaaccctctttacaatcatctc
aatttcacccttaaaccctcttcaatctcccttcttaaaccccttttcttctccttaaac
cctaaatcaacaaccatgtcctcttcctctcctccccatcctcctcctcctccgcgctcc
gcattcgctgtccttatggccaattccaagaagaaaactccttcacaggactcctcaccc
aagaaacgtaaaaccccacatgttgaaagttctagtaaaagctctgaagttaatcaaggt
tcagttttgaagccaattaaggacacccatttggacaatttgtcgaaaagtgaggagctt
gtggtggggaaggaagggaatcaagattcagttttgaagccagctgaggacacccttttg
gacaaagactcgaaaaatgaggcgctggtgaagaagaaagggaatcaagattcagttttg
aagccaattgaggacacccaaatggtcaatgagtcgaaaaatgaggtattggtggagaag
aaaaggaataaagattcagttatgaagtcaattgagggcacccaaatggttaatgagtcg
aaaagtggggagttagtggcgaagaagaaaaggaaaatgataagtccagaagagagcatt
gtggagataaagaaaaaagctgcaaattttgatccaagaaaggcagcatattggggggat
ggtgagagagtgccattcatgtttgtagttaaggcatttgacgcgatttcgaaggagtca
ggaaggattgtgattactgagattgcgactaatatgttgaggactgtgattgagacgaca
cctgaggatttgctgcccgttgtgtacctttcagctaacaagatcgcagctgcacatgat
ggtttggagcttggtgttggtgatgcttcaattatcaaggcgcttgctgaggcctgtggc
gctaaagaagcacatatcaagaagcaatacaaggagcttggagacttgggccttgttgca
aaagcgagccgttcatcacagcctctcatgcataaaccagaagctctgactgttgccaaa
gtttttgacaaatttcggattattgcgaaggaatctggaaaggatagtcaggaaaagaaa
aagaattacattaaatcactgcttgttgcagcgactgattgtgaaccccaatatttgatt
cgtcttctccagacaaagttacgtattggtttggctgaacaaacactcctagtcgcactc
gctcatgcttttgtgtactcagataagcattcatcaccccccgcaggtgtagattctcct
ttagaagaggcagccaagattgttaaacaagtgtactctgtaatcccagtttatgaaaaa
attgtccctgctcttctagctgatggtgtttggaagctttcagaaacatgcagtttctca
cctggtgttccagttggacctatgctagctaagccaacaaaaggagtatctgaaattctt
gataagtttcaggatatggagttcacatgtgaatacaaatatgacggtgaacgtgctcag
atacactacatggaagatggttccgttgagatatacagccgaaatgcagaaagaaatact
ggaaagtttccagacgttgttgctgctatctcaagattgaagaaatcttctgctgcatca
tttgttctagactgtgaactggttgcatacgaccgtgagaaacagaagattctgcccttt
caggtccttagtacacgtgctcgtaagaatgttgtcattagtgaaatcaaggtcaacgtg
tgcatatatgcctttgatatcttgtatcttaatggacaaccactacttcaagagcaactt
aacgttcgcagagagcatctttacaagtcatttgaagaagaacctggatatttccagttt
gctacagctgtagcctcaaacgatcttgaggaaataaccaaatttcttgaagatgcggtc
aacggcagttgtgagggtttgattatcaaaacactaactacagatgccacatatgagcct
tcaaagcggtcaaataactggctaaaactgaaaaaggactacatggagagtattggcgac
tcgctggatctggtaccaattgctgcttttcatggtcgggggaaacgtactggtgtttac
ggagcctttctcctagcttgttatgataacaacaacgaggagtaccagagcatctgtaaa
attggaactggattttctgaagcaatgcttgaagaacgctctgccagccttcgttccaaa
gttattcctaaaccaaagtcatattacaggtatggggaaaccatcaatccagatgtatgg
tttgaagctactgaggtatgggaagtgaaagctgctgatcttactatcagtcctgtccac
cgtgctgcccaaggtatcgtggatcccggcaagggaatttctttacgatttccacgtttg
atgcgtgtacgagaagacaagaaccccgaggaggcctcatcggcagagatggtcgcggat
atgtacaacgctcaaaagcacaatcacaaaaacaatcaggatgacaacgatgaagactaa

DBGET integrated database retrieval system