KEGG   Capsicum annuum: 107847894Help
Entry
107847894         CDS       T04646                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cann  Capsicum annuum
Pathway
cann04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cann00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107847894
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107847894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-GeneID: 107847894
NCBI-ProteinID: XP_016547975
UniProt: A0A1U8EX49 A0A2G2YHJ7
LinkDB All DBs
Position
11
AA seq 209 aa AA seqDB search
MASHTIFTTTPTSTNSFLFPNSSSFYGVSLYVKSKFSQSLTLYAVTTPKPLTVFAATKKA
VAVLKGSSNVEGVVTLSQDDDGPTTVNVRITGLTRGLHGFHLHEYGDTTNGCMSTGAHFN
PNNLTHGAPGDEIRHAGDLGNITANADGVAETTIIDNQIPLTGPNSVVGRALVVHELEDD
LGKGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccacacaatctttactaccactcctacctctaccaattctttcttattccca
aattcttcttctttctatggtgtttccctttatgttaagtctaaatttagccaatctttg
accctttatgctgttactactcctaaacctcttactgtttttgctgctactaagaaagct
gttgctgttcttaagggaagttctaatgttgagggggttgtcactttatctcaagatgat
gatggtccaactacggttaacgttcgtataactggacttactcgtggacttcatgggttt
catttgcatgaatatggtgacactacaaatgggtgtatgtctacaggagcccatttcaat
cctaataatttgacacatggagctcctggagacgaaatccgtcatgcgggtgacctggga
aacataacagccaatgccgatggcgtggctgaaacaacaattattgataatcagatacca
ttgacgggtccaaactcagttgttggaagagcacttgtagttcacgagcttgaggatgac
ctcggaaagggtggccatgaactcagccttaccacaggcaatgctggcggacgattggca
tgcggtgttgttggtttgactccaatatga

DBGET integrated database retrieval system