KEGG   Capsicum annuum: 107848079Help
Entry
107848079         CDS       T04646                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cann  Capsicum annuum
Pathway
cann00010  Glycolysis / Gluconeogenesis
cann00053  Ascorbate and aldarate metabolism
cann00071  Fatty acid degradation
cann00280  Valine, leucine and isoleucine degradation
cann00310  Lysine degradation
cann00330  Arginine and proline metabolism
cann00340  Histidine metabolism
cann00380  Tryptophan metabolism
cann00410  beta-Alanine metabolism
cann00561  Glycerolipid metabolism
cann00620  Pyruvate metabolism
cann00903  Limonene and pinene degradation
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107848079
   00053 Ascorbate and aldarate metabolism
    107848079
   00620 Pyruvate metabolism
    107848079
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107848079
   00561 Glycerolipid metabolism
    107848079
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107848079
   00310 Lysine degradation
    107848079
   00330 Arginine and proline metabolism
    107848079
   00340 Histidine metabolism
    107848079
   00380 Tryptophan metabolism
    107848079
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107848079
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107848079
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107848079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107848079
NCBI-ProteinID: XP_016548233
UniProt: A0A1U8EM11
LinkDB All DBs
Position
11
AA seq 533 aa AA seqDB search
MAARVFASRFFTSSSRLLSKGKRSHLGRIAAYKYSTAAAVEEPIKPAVNVEHTKLFINGQ
FVDAASGKTFPTLDPRTGEAIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERSKIL
LRLADLIEKHNDQIAMLEAWDTGKPYEQAAKLEVPMVVRVLRYYAGWADKIHGITVPADG
PXHIQTLHEPIGVAGQIIPWNFPLLMLSWKIGPALACGNTIVLKTAEQTPLSAFYVANLL
QEAGLPEGVLNIISGFGATAGAPLCSHMDVDKLAFTGSTDTGKTILTLAAKSNLKPVTLE
LGGKSPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKARALK
RTVGDPFKSGNEQGPQIDSKQFDKIMKYIRSGVESGATLETGGEQHGKKGYYIKPTVFSK
VKDDMLIAQDEIFGPVQTILKFKDLNEVVQRANNSRYGLAAGVFTQNIDTANTLARALKV
GTVWINCFDVFDAAIPFGGYKMSGQGREKAEYSLKNYLQVKAVVTALKNPAWL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtgtttttgcatctcgctttttcacttcctcttctcgtcttctttcaaag
ggaaaaagatctcatctgggcagaatagctgcttataaatacagcactgcagctgctgtc
gaggagcctatcaagccagctgtcaatgtcgaacatactaaactttttatcaacgggcaa
tttgttgatgctgcatcaggaaaaactttcccgaccctcgaccccaggacaggggaggca
atagcacatgttgctgaaggtgatgcagaggatattaatcgggcagtggctgctgctcgt
aaggcttttgatgaaggaccatggcctaagatgactgcttatgaaaggtcaaagatattg
ctgcgccttgctgatctgattgaaaaacataacgatcaaattgcaatgctcgaggcttgg
gacactgggaagccttacgaacaagctgctaaacttgaagtaccaatggttgtacgtgta
ctccgttattatgctggctgggcagataaaattcatggtattaccgttcccgctgatgga
ccatagcatattcaaacattgcatgaaccaattggggttgctggtcagattatcccatgg
aattttcctctcctcatgctttcgtggaagattggccctgctttagcttgtggcaacaca
atcgtgctaaagacagctgagcagaccccattatctgcattctatgtagcaaatcttttg
caggaggctgggctgcctgaaggtgttctgaatatcatttctggttttggtgccacagct
ggtgctcctctctgtagtcatatggatgtggataagcttgcttttactggatcaacagat
acagggaaaactatacttacattggctgctaagagcaatcttaagcctgtgaccttggaa
cttggagggaaatccccgtttattgtttgtgaggatgctgatattgatacagccgttgaa
caggctcacttcgctttgttctttaatcaggggcaatgttgctgtgctggatctcggacc
tttgtccatgagaaagtttatgatgaatttctagagaaggcaaaggcacgtgccttgaaa
cgaactgttggtgatccgtttaaatcgggcaatgagcaaggtccacagattgattcaaaa
cagtttgataagatcatgaagtacattagatctggtgttgaaagtggagctactcttgaa
actggcggtgagcaacacggtaaaaagggctactatattaagcccaccgttttctctaaa
gttaaggatgatatgctgattgcacaggatgagatttttggtccagttcagaccatctta
aaatttaaggatcttaatgaagtggtacagagagctaataacagtaggtatggtctagct
gctggagtatttacgcagaacattgacactgcaaacaccttggcgcgagccttgaaagtt
gggacggtatggattaattgctttgatgtctttgatgctgcaattccttttggtggctat
aagatgagtggccagggaagagaaaaggcagaatacagtctcaagaattacttacaagtg
aaggcagttgtgaccgcattgaagaatccagcatggttataa

DBGET integrated database retrieval system